SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC001319 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  TC001319
Domain Number - Region: 191-225
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000126
Family Rho termination factor, N-terminal domain 0.051
Further Details:      
 
Domain Number - Region: 557-589,627-673
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00753
Family Di-heme elbow motif 0.066
Further Details:      
 
Domain Number - Region: 118-155
Classification Level Classification E-value
Superfamily SAP domain 0.0687
Family SAP domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC001319
Sequence length 965
Comment GLEAN_01319
Sequence
MELSKDELRKMTLEEIIKLTKGDLKKVGDIIEQISEGNSSSNSDKSSSLTHESSSMDKYF
LTPQSNNEIVLNKLSLKKIKAIAKKMGLKNYSQYNSKTKLDLIKLILKEELINAGDWFNK
LNRLNIKKLKSIAEKLGLKIKQNSKKTDLVNQISDNALMSEANLNTVLKEIGSQSLEELL
EETMSKNESTQNTSIKELRKIAKEKNITGYSKMKKAELLQKINDQPFAFEDSYFTELSKK
SKIKIIETKAEYTKKWKKHKVYYKVILLKAEEEDSPKSDLSDIIMKKITVIREGLNEMIK
IVKEKTNFKEGDLMNIVVNHPDLWNPISTGLSRTTEIDNLLNNIQSILTSNQDLDIYGCT
FHAEVVNMPRGAGSGVKMLNIAEDSRTKKSITRINNKDRLCCPRAVIVGLTYQTNIILGK
EFNDNDITYIRKGRNLQTTLAQELCNQLKEYNEEYFTLRDIANIEKVLNIQIKVIAAECF
NQVIYSGEEKDVKVYLYKNGNHFDTINNMTAFYSQSYYCEKCDKPYQHKDNHKCKKGVKI
CILCLKPKHEEGSKQRIYCEKCNRYCFNPECLANHSEVCERFRKCLNCNKILKRGDKMLE
EGNNKKGNKMVKEGRKMNDHRCGWEICRNCYKEVEILEHKCYMQWIRQKGGICETIMKDG
DNKYKVKGCQNCDRKGCTVTFPDETNKQSNKGKETLSLKDLEKGSGYTITDLQLFTKDGK
EKAVVILNNEFKLFLPDRLAKRGDELIGYMLEYDLVMTYNGLIDVKNNAGFTYKIHDITF
KKMDKRPDKTNKYPDETNKHPDETNKHPDKTTERIKYHIYQCKDCKNCAKKPLDDEEPFK
CVKCGSKYHTTKCSYTEKYLFFDYEAMQETGKHIANLAISHDFSGNVNSFETNEDFCKWL
ISRDHKGYTAIAHYSKGYDSYFILKHCVENGIKPFCVYNGSKIMLMEIKSINLRLLVVVI
LFKDL
Download sequence
Identical sequences D6WBX4
TC001319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]