SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC001811 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC001811
Domain Number 1 Region: 591-624,750-799
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000502
Family Cytochrome c3-like 0.033
Further Details:      
 
Weak hits

Sequence:  TC001811
Domain Number - Region: 194-228
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00224
Family Rho termination factor, N-terminal domain 0.038
Further Details:      
 
Domain Number - Region: 812-921
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00278
Family DnaQ-like 3'-5' exonuclease 0.035
Further Details:      
 
Domain Number - Region: 282-394
Classification Level Classification E-value
Superfamily Influenza hemagglutinin (stalk) 0.0297
Family Influenza hemagglutinin (stalk) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC001811
Sequence length 929
Comment GLEAN_01811
Sequence
MGLSKDELRKMTLEEIIKLTKGDLKKVGDIIEQISSSSSTKSHDESKIQSSDKSSPLTHE
SSSMDKYFLTPQSNNEIVLNKLSLKKIKAIAKKMGLKNYSQYNSKTKLDLIKLILKEELN
AGDWFNKLSRLNIKKLDLKIKQNSKKTDLVNQISDNVNNEANLNTVLNEIGSPKLEETMS
KNESTQNTSLTSASHTTIKELRKIDKEKNIKGYSKMKKSELLQKIGRCPHERSEINDQPF
AFEDSYFTEFSKKSKIKIIETNAEYTKRWRKHKVYYKVILLKDWQGQSRGHQRFPRESKD
SGGKAEDEESSESDLSDIIMKKITAVREVLNEMIKIVKQKTNFKEGDLLNIVVNHNDLWS
PISTGLSRTSDIDNLLNKIQSILTSNQDLDIYGCTFYTEVVNMPRGATNAKRILNLAEDS
RTKKSITSIKNKDNLCCPRAVIVGLTYHTNIILGKEYDHNDIIYIRKGRNLQTTLAQELC
NQLGEYNRNYFTLDDIANIERLLNIQIKIVAAECFNSIIYSGPEKDVKVYLYKNGNHFDT
INSMTGFYGQSYYCKKCDKPYQIKDGHKCLKVKKTCLMCFNPKHEEDSKQRIYCEKCNRY
CFNQECLENHSEVCERFHKCLKCNKILKRGDKMVDEGKKMIEQGNKMIEEGDNMKGIYII
DEGIDTMTRLAMISKGDKIIKKGNQIIKKGNKMIEEGGKEHKCGWEKCLNCYKEVEILKH
KCYMQWKRQKGGFYQTKIKENDEEYTVKGCKNCNEKGCTIIYSKEKVENKNYWVYQCGNC
KIVIKKPLNDTKPFKCVKCRSKYHTTKCSYTEKYLFFDYEAMQETGKHIANLVISHDFSG
NVNSFKTNEDFCKWLFSRVHKGYTAIAHYSKGYDSYFILKYCVENGIKPFCIYNGSKIML
MEIKSINLRIIDSSNFVQGPLKISLKHLV
Download sequence
Identical sequences D7EKJ0
TC001811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]