SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC001954 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC001954
Domain Number 1 Region: 199-232
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000785
Family Rho termination factor, N-terminal domain 0.048
Further Details:      
 
Weak hits

Sequence:  TC001954
Domain Number - Region: 668-721
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0003
Family C1 set domains (antibody constant domain-like) 0.073
Further Details:      
 
Domain Number - Region: 120-159
Classification Level Classification E-value
Superfamily SAP domain 0.0742
Family SAP domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC001954
Sequence length 811
Comment GLEAN_01954
Sequence
MTLEEIIKLTKGDLKKVGDIIEQISEGNSSSSSTKSHDESKIQSSDKSSSLTHESSSMDK
YFLTPQSNNEIVLNKLSLKKIKTIAKKMGLKNYSQYNSKTKLDLIQLILKEELINAGDWF
NKLNRLNIKKLKSIAEKLGVKIKQNSKKTALVNRISDNVNNETLNTLLNEIGSSRLEEIL
EETMSKNESTQNTSLTSASHTTIKELRKIAKEKNIKGYSKMKKAELLQKIEEMEPFAFED
SYFKEFSKKSKIKIIETNAEYTKRWRKHKVYYKVILLKEEESSEPDLSGLIMKKITVIRE
GLNEMIKIVKEKTNFKEGDLLNIVVNHNDLWSPISTGLSRTSDIDNLLNKIQSILASNQD
LDIYGCTFYTEVVNMPRGATNAKRLLNIAEDSRTKKSITPIKNKDNLCCPRAVIVGLTYQ
TNIILGREYDHNDIRYIRKGRNLQTTLAQELCNQLKEYNEEYFTLRDIANIEKVLNIQIK
VIAAECFNQVIYSGAEKEVKVYLYKNGNHFDTINSMTAFYGQSYYCEKCDKPYQHKDNHK
CKKGNKICILCLKSKHKEESKQRIYCEKCNRYCFNQECLENHSEVCGSIYKCLGCNKLLK
RLDKMIEEGNKMIEEGNKMIEEGKNMMEIYIIDEGIDTMTRLANISKGNKIIEEGNKMIE
EDVPEEDPVMSFEKDLLEMGYTVRGNCTSPPSYPPVNITWFLNGKKINESSLRHIPVPNA
IVTDNRRQPVITQSALELEIDGSTFEGGKARIQCVATLFHLYRREVELVFEEEKPRPRPS
SELRTRDATDGCKGRYANAALLIGLVLVALR
Download sequence
Identical sequences TC001954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]