SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC004440 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  TC004440
Domain Number - Region: 2293-2327
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000247
Family Rho termination factor, N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC004440
Sequence length 3096
Comment GLEAN_04440
Sequence
MVFESVLTQVLNRFLGAYVENLDTNQLRVGIWGGDVELKDLVLKQSALDDLDLPLQTIYG
RIGKLVLKIPWKNLYGAAFVINIEDIYLLAAPNQQVIYNEEKEEIKKSEAKKREILKVEL
AKKQEADKDKPKADNTFVEKLVTQIIKNIQLNIKNIHIRYEDKVTSPTPFALGITLSDLH
VVSTDENWKPAITKEDITKIFKIVTLDGLAIYWNSNTACYDGLPKVDMLHKMCTEIASKN
NTPINYKYVLGPINASARLRINQRPELDKPAFTIPKIHLNLDMERLFVGITKAQYRDIIA
LGDSMDRMMKGTPYRKFRPNVPSYKGNYKTWWHFAYNCVLEGEVRRRRRNWDWNHICKHR
DLCREYGTLYEKKLQNKATSDELSRIEECEKVIDVFNIVIIRQRVEFENERRVKTKGPEK
GWFGWMWGSKTSIDSDSLESDSGTELRKQFQNAMTKEEKERLYKAIGYQENALPSEFPEA
YVDNSCTFILRTLEVELSDDSGNVKRVVFTELKGVKCRVDTRAAANALKLHVKIDEFQTF
GLQQDDFLPKIITSETGKDDSGLLQVLFETNPLDKKCGQRLHVTSQPLKIVYDAQTVLKA
IEIFKVPSSSALDQISAAADSGLSNMKEMTSSGLQHAIDTHVHLDLKVDFRAPYIIIPYG
GKYTENENVLVVNLGNFQMHSLDRPPRRDVRQMYAEGCDEKEILTQLMAQSYDQFALELT
RVQILIAQSDEDWEVHVSEVKTSDMHILEPINLKVNLATCMITDDPKLPHMKISGELPSI
IVNVSDARLLLLMALGNSIPLPQSDIPEPTPLAKVAKRESSMMLRYLEMQEKASKTQTLL
PSTAKKTDDQLVQFTTLEIHFAMSELLLNVKHQSDIASPITNIACFSVKSLELGLVQQTY
NTKITLDLGGVSLIQTHDSKEIKMISSPSFEEDEQYLFQIKFTQVNKNSPEFHSTYKSCE
ASLALEFAKLGIILHKEGLLSLIQFATSLQTEIDDIWGSRPVERVASTHTPSFKSQLSTI
SEGLGSQLAPQEKKRKHKETKIVVETIKFKLSANVQEVNVEFATEHERISFWALKGVHSN
IIVKEPYTQINANLNQIVVVDLNPKTIHNLILTVEGTEALSTRIVLYNLDKMSESDKSDI
SVDLTMGGLRIIFLNWFVTRMLDFLNEFQTAQAAIIEASQAAAKTAKENMQNVYEKATKL
SLSINLKAPDIIIPENSKSYDAILLDLGHISISNQFLTMDIRNEQNFSAVIDEMKLNLTD
MKLSRVKLTTRDEIDKELTLLVPLTFKLTIKRNLSTSWYKAVPDIDITGRIFSITVLLSQ
LDYKTIMSVLNGNLSEGQKKGAPAKQPPKEVIEGTKVISDDKALITIHEKQSGHEEKDAK
TNTFLRLTFTMDNLVMTLFTGGSKALSSDSPAHDERHALARFSLEGVSVKVRMLTDNSMI
ASFLLLNCLLDDMRVGREGKLNRLVQRSQDFGAAPSVSMVSISETSASKSMIDIVVQMKD
KDIFTDVRVYSFTLILSVDYLMKIADFLTIPQEEVKEAPKASKSNTSTKSAISSGMMEME
EKASQITLNLKIEKPDIVLVEHMDSIDTQAMILNSEVVMKLRMSGEHQVINGSIKDLQLY
TCNYNQLKRIDTKSNVLHPVTISLAGSTPENKGLHLELLVTDIRLSVSPATIELLSRVTA
TATGSSAERTSEDEELQDHSDVWEHKSFEDEDYWFFRNDEAVEATEALSISSSIVPKSPN
KTQEMCIISMPSIILTIEAGVGSKTFPMLVLESSLKGHVNNWSSQLSVEAGLTLQMNYYN
SRLALWEPLIEPVEVSHSNKPKWVPWELKLEVSRNEPEEVTTPTDLESLDSAPQQAAMCI
DVSSDHSIEIVVTKTCLEVLNNLGKAFATAMKPGEVKMLETMAPFKIVNELGCSVCVNLE
RGSFALFGGEELAEVILESGAEAQLQKKPMVLSSPSRLGLQLTTDALSVKNYFVNVKVID
KNCNIDLPVVRADKRFFPLNYRGDGNDHWGLISDVTVDEGVTIITLRSILKVYNHFNIPI
EVYYMTVRGNELESITTIQPDSHVNIPLKAVYTPTNELFFSVGGYSVTTAPYIWKDLQTN
LTITKTLQCQPKEAELGNDPFIIQAVGEMEQVYYENTSRHTMSSTCYNIHLRPAVVFKNC
LPIDIICCIENTVSEIPVEPGKTLLLPNVEPGRSALVIRTKLDLIQLILKEELINAGDWF
NKLNRRNIKKLKSIAEKLGVKIKQNSKKTDLVNQISDNALMSKANLNTVLKEIGSQSLEE
LLEETMTKNESTQNTTIKELRKIAKEKNIKGYSKMKKAELLQKINDQPFAFEDSYFKEFS
KKSKIKIIETNAEYTKRWRKHKVYYKVILLKEEESSESDLSDIIMKKITAVREGLNEMIK
IVKQKTNFKEGDLMNIVVNHPDLWNPISDINNLLNNIQSILTSNQDLDIYGCTFNAEVVN
LPRGATNAKRLLNIAEDSRTKKSITSIKNKDNLCCPRAVIVGLTYHTNIILGREYDHNDI
RYIRMGRNLQTTLAQELCNQLGEYNRNYFTLDDIANIERLLNIQIKIVAAECFNSIIYSG
PEKDVKVYLYKNGNHFDTINSMAGFYGQSYYCKKCDKPYQIKDDHKCKKEKKMCLMCFNP
KHEEDSRIYCEKCNRYCFNQECLENHSEVCERFHKCLKCNKILKRGDKMVDEGKKMIEQG
NKMIEEGNNKKGNQIIKKGNKMIEEGCKEHRCGWEKCRNCCKEVEILKHKCYMQWKRQKG
GICQTKIKENDKEYTAYPKSKTMTSEYVLRKNRKKGGKSTRGPPGIGFNLTENSDYDIAG
HKLVNVKQPENPGDAVNLQYLASANDNMIKKDDSESILKIVKLELSNMIKKDDSETVLKI
VKPELSNMTKKDDSETVLKIVKPELSNMIKKDVSESVVKIVRQSLDSANINATKRYIDIG
NRRLVKTADAIDKYDVVNKGQLDIYGERLINLETEFMKKTHYSFLQFVGKINFEKGIHDK
RTITMLKFTFDGEYYLSIPINMEVIKFRSTADLKDLEITNNEMKTFDLSNPFSDLLLFRI
KKEKVNTDENLGGYNHNKPYKLRTPIRFYMLVKFSL
Download sequence
Identical sequences TC004440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]