SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC004441 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  TC004441
Domain Number - Region: 33-67
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000157
Family Rho termination factor, N-terminal domain 0.054
Further Details:      
 
Domain Number - Region: 400-431,488-508
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0243
Family Cytochrome c3-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC004441
Sequence length 720
Comment GLEAN_04441
Sequence
MSEANLNTVLKEIGSQSLEELLEETMSKNESTQNTSIKELRKIAREKNITGYSKMKKAEL
LQKINDQPFAFEDSYFTELSKKSKIKIIETKAEYTKKWKKHKVYYKVILLKDRQDEESSE
PDLSGLIMKKITVIREGLNEMIEIVKEKTNFKEGDLLNIVVNHNDLWSPISTGLSKTSDI
DNLLNKIQSILTSNQDLDIYGCTFYTEVVNIPRGATNAKRLLNIAEDSRTKRCIALIKNK
DNLCCPRAVIVGLTYHTNIILGREYDHNDIRYIRMGRNLQTTLAQELCNQLGEYNRNYFT
LDDIANIERLLNIQIKIVAAECFNSIIYSGNEKNVKVYLYKNGNHFDTISSMTAFFGQSY
YCEKCDKPYQNKDEHKCKKKDKMCIMCFKSNHKDSVKRIYCEKCNRYCFNQECLENHSEI
CERFHKCLKCNKILKRGDKMVDEGKKMIEEGNKIIEEGNNKKGNQIIKKGNKMIEEGSKE
HRCGWEKCRNCNKEVAILKHNCYMQWKRQKGGICETIMKNGDKKYKVKGCKICDRKGCTV
TFPDKTNKQTNKGKETLLLKDLEKGSGYSITDLQLFTKDGKEKAVVTLNNEFKLFLPDRL
AKRGDELIGYMLKYDLVMTYNGLIDVKNKAGFTYKTHDITFKKMDKRPDKTNKHPDKTTK
RIKYHIYQCKDCKNCVKKPLDDEEPFECLKCGSKYHTTKCTYTQKYLFFDYEAMQETANT
Download sequence
Identical sequences D6WCW0
TC004441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]