SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC005550 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC005550
Domain Number 1 Region: 152-248
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.31e-27
Family Insect phospholipase A2 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC005550
Sequence length 261
Comment GLEAN_05550
Sequence
MWLFFLLSLLGPSGALNLPAIGPFRNFGQRGESSFHIKSYTGRRVKNDSIRMVYFHDQTV
AIVELQPDKLLLNCELIEVYQPEDAIKALGDFQHVSRPVAISFKEMTTLMRQCQQVEDGK
SVHDELAKNITAHPIAGRGILANNPFVLLSGIIPGTKWCGTGDIAKDYYDLGAEPTVDKC
CRAHDLCPVKVRAFSQRYNITNDSLYTKSHCLCDDQLYSCLKENPSPTAHIMGTIYFNLV
QIPCLEDTQHGKVFRKPKERF
Download sequence
Identical sequences C0LTQ2
TC005550 NP_001139390.1.52716 7070.C0LTQ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]