SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC006914 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC006914
Domain Number 1 Region: 866-1285
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6e-53
Family DNA polymerase I 0.012
Further Details:      
 
Domain Number 2 Region: 625-685
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.000000000153
Family Recombination endonuclease VII, N-terminal domain 0.0053
Further Details:      
 
Domain Number 3 Region: 616-762,827-855
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000986
Family DnaQ-like 3'-5' exonuclease 0.038
Further Details:      
 
Weak hits

Sequence:  TC006914
Domain Number - Region: 107-143
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000942
Family Rho termination factor, N-terminal domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC006914
Sequence length 1327
Comment GLEAN_06914
Sequence
MPPLRNSDRVLVSEANSEIFSFDDDLFAKPRKKRVRKIKCDICGKYIKSTRMQLHKEKEN
KKNLKTFQFDDDIFAKPKKNRVKKVKCDMCGTYIEETRIHLHKLKHDLNSRRLLELRNMA
KSLGIRYIKRYNKAELINEIINAEEQLKIKRENKKSLEIFPFDDAIFSKLKKERVRKIKC
DECGKYIKESRMQLHKARHNLEPDFILVQVAFKGRLLTYQHNNLEEGIDMETYMDMIKEK
AIKIIINALNLHKNIKTNLEMECEFMKLENEDYTMIHKFQLPNVILREKDALEEYWDEQK
DLFISRCDELQEKGSGWTLKNINHLRININKYTPLSGNSYVELPKWIKDKKACVNVKNND
NKCFMYSIISCLHQAKEHVDRLNHYNKPEYINELNFEGINFPVKIQDIPKFESHNKINVT
VFSYEEQIFYPLYHNKKRFYEMNIDLLYFGNKDNNHYCWIKNLSRLLNDQLEINRSKKYF
CRRCLNYSARTEDALKKHQNVCFSNEPCVPNMPDDNVLKFKNIQRMLRHPYVIYSDFESI
LKPIPTCEPNPESSYTHKTQFHVPCGYGLYIKSAYNNIDNPLEIYRGEESDKRFIKRITE
HTRTIYKLLKENKPIKDIELEEYEKTKICYLCENVFSIENPKVRDHDHYTGKYRGAACRK
CNLKYRQPLFIPILFHNLSSYDCHLFIKNLGEDKSQLKLIPNNEEKYISFGKILRMDDNG
YIELRFIDSFRFLASSLDNLSSNLESSQLREIIKYFSNSELDVLFRKEKSKIIRKGIYPY
EYMDSFEKFFETKLPSIDKFYSSLTKEGISQEEFEHAVKVWKHFKIKNLGEWHDLYLKLD
VLLLTDVFENFRDLCLEKSYGLDPVWYYTTPGLAWDCMLKYTSVELELLTDYEMYLFFEK
GIRGGISQCSNRYSQADENTQIIYIDANNLYGWALSQKLPEKDFKWLTCDEIKNVDGILV
SDSDTGYVLEVDLAFPVDLAIHNKFNDLPLAPENRIPPGGKVEKLLCHFYDKKNYIIHYK
TLKLYKSLGIRITKVHRGIKFTQSNFIAPYVKFNTEQRQKAKNDFEKDFWKLMVNAPYGK
SMQSVRNQQNIKLYCDEEKLQKAINKPNFKHRTIFSKHLAAVHNFKTKVLFNKPIYIGQA
VLDLSKLLMYNFHYNVIKKEFNQNVKLLYGDTDSFIYEIKNADFYEFMKNNPDYFDTSDY
PKDHSLYSDKNKKVIGKFKDELNGIKILECIGLRSKMYSYRTETSVSKKLKGIKKAVLKK
EISFEDYKNCLFNQKEYFHTQKVIRSHKHDIFTEEVKKKSLSWKDDKRYLLPDSTDTLAY
GHVLVSS
Download sequence
Identical sequences D7GXL4
TC006914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]