SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TC006918 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  TC006918
Domain Number - Region: 26-63
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00208
Family YqbF C-terminal domain-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC006918
Sequence length 67
Comment GLEAN_06918
Sequence
MALLQFFNSKPNEEHLFRCMKALSKFVQISAQEVPQLIQMIGPDPRSFKGTSERIDQLIE
QIGAKLR
Download sequence
Identical sequences TC006918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]