SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC008591 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  TC008591
Domain Number - Region: 15-68
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.0123
Family Insect phospholipase A2 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC008591
Sequence length 492
Comment GLEAN_08591
Sequence
MLSFKGEGLLNTAINKLPFELHLPGYQYCGPGTKLKKRLERGDPGINKLDSFCKTHDIAY
ANSNDLKDRHQADRILEDSAWSRVKSKDASFGEKASAWFVTNAMKVKRKLGMGIQRKKSK
RKTKKSRKRTQKKQQPFHKALLSNLENKGYDNIKSALSAARIAVRKSGGRKRIKIPRIIP
IKTGGFLPLLPLIFGGLSALGAMGGGAAAITKAVNDAKAAKQKLDENKRHNKVLEDIAIG
KAGSGLYLRKQPRGYGLYLRVESTLSEHYEPPIDLEENSNYSIALIGFYTNNNIPNIEEG
TNKFYYFAPNTTEEKVITFPKGAYEIAAIEKYIQIILSGRSATDAQKQNTFSLKANENTL
KCEIFSIYDINFAHEDSIGKLLGFSKRKLKARQLHESDLPVNIIKVNTIRIECNIVRGSF
YKNKESHTLYETALSVSPAEQIFVEPLNPIYLPIINRSNIPNLTIDIVDQDHCPIDFNGQ
TINIRLALKKEA
Download sequence
Identical sequences D7EID9
TC008591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]