SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC009112 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC009112
Domain Number 1 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.83e-18
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00019
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 8.63e-17
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TC009112
Sequence length 112
Comment GLEAN_09112
Sequence
MSYQLYRNTTLGHTLQESLDELIQYGQITPQLACKVLLLFDKSINMTLATRVKSRLTFKA
GKLNTYRFCDNVWTFMLNDVEFREVQEITKVDKVKIVACDGKSVGDEGSSKK
Download sequence
Identical sequences D6WU86
TC009112 XP_008195523.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]