SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC010233 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC010233
Domain Number 1 Region: 890-1025,1065-1095
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.49e-17
Family DnaQ-like 3'-5' exonuclease 0.02
Further Details:      
 
Domain Number 2 Region: 1230-1351
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000000000326
Family DNA polymerase I 0.011
Further Details:      
 
Weak hits

Sequence:  TC010233
Domain Number - Region: 206-239
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000153
Family Rho termination factor, N-terminal domain 0.06
Further Details:      
 
Domain Number - Region: 1166-1239
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.00107
Family Very short patch repair (VSR) endonuclease 0.0099
Further Details:      
 
Domain Number - Region: 568-602,659-706
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00343
Family Cytochrome c3-like 0.076
Further Details:      
 
Domain Number - Region: 121-162
Classification Level Classification E-value
Superfamily SAP domain 0.0915
Family SAP domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TC010233
Sequence length 1357
Comment GLEAN_10233
Sequence
MTLEEIIKLTKGDLKKVGDIIEQISEDNSSSSSTKIQSSDKSSPLTHESSSMDKFASAHE
GIAEYFLTPQSNNEIVLNKLSLKKIKAIAKKMGLKNYSQYNSKTKLDLIKLILKEELNAG
DWFNKLNRLNIKKLKSIAEKLDLKIKQNSKKTDLVNQISDNVNNEANLNTSLTSASHTVL
NEIGSPKLEEILEETMSKNESTQNTSLTIKELRKIAKEKNIKGYSKMKKAELLQKINDQP
FAFEDSYFTEFSKKSKIKIIETNAEYTKRWRKHKVYYKVILLKAEDEESSEPDLSGLIMK
KITVIREGLNEMIKIVKEKTNFKEGDLLNIVVNHNDLYSPISTGLSRTSDIDNLLNKIQS
ILTSNQDLDIYGCTFHAEVVNMPRGATDAKRLINIAEDSRTKRSIIQIKNKDNLCCPRAV
IVGLTYQTNIILGKEFNDNDITYIRKGRNLQTTLAQELCNQLGEYNRNYFTLDDIANIER
LLNIQIKIVAAECFNQVIYSGEEKDVKVYLYKNGNHFDTINSMTGFYGQSYYCKKCDKPY
QIKDDHKCKKVKKTCLICFTKHEEDSKQRIYCENCNRYCFNQECLENHSEVCERFYKCLN
CNKILKRGDKMVDEGKKMIEQGNKMIEEGDNNKGREMIEKGNKLIEEGGKEHKCGWEKCR
NCYKEVEILKHKCYMQWIRQKGGICETIMKDGDNKYKVKGCQNCDRKGCTVTCEASTKWA
FPDIKETLLLKDLEKGSGYSITDLQLFTKDGKEKAVVTLNNKFKLILPDRLAKRGDELIG
YMLEYDLVMTYNGLIDVKNKAGFTYKTHDIRFKKMDKRPDKTNKYPDETNKHPDEHPDEH
PDKTTERIKYHIYQCCNCKNLNKKPLNDTKPFKCVICRSKNHTTKCSYTEKYLFFDYEAM
QETGKHIANLVISHDFSGNVNSFKTNEDFCKWLISRGDKGCTAIAHYSKGYDSYFILKYC
VENGIKPFCIYNGSKIMLMEIKPINLRIIDSSNFVQGPLKNFPKTFGLKELKKGYFPHFF
NTTENQNYIGKIPDTKYYGVNSMKPKEREEFLEWHKQKRKENYLFDFKKELYEYCNSDVD
ILRNGCLELRKQFLEIANIDPFRYVTIAGVCMAIYRSKYIKKDTIAVVDNLKDQYSQQSI
SWLNSFHNPNIKHALNNGEVKICGSKVDGFDEKSNTVYQYHGCFWHGCTKCYSSDFLNNK
NKTTMEDLYEKTIERSEQIKKGGYNLIEMWECEWTKSKEYKKEMKQIEEEIKELEELNPR
NAFFGGRTNATKLRVKRKKLKYIDICSLYPTVQCYDDYPIGHPTKIFKPRTYDPEWYGLI
KCAILPPRGLYHPVLPVKNKNKFGQSPHDRWNLVMKS
Download sequence
Identical sequences D7GYA2
TC010233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]