SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC013420 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC013420
Domain Number 1 Region: 60-192
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 2.15e-34
Family Insect phospholipase A2 0.0000343
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC013420
Sequence length 193
Comment GLEAN_13420
Sequence
MFCKTSIWLLIFSSYIIEINGRDVIAGIRDELSKISSNLDRNKIFSGGTTEGFLSKIRLI
FPGTLWCGDGNIADSSKELGKLKSTDSCCRAHDMCPDDIPAGQSKHGLVNNGLFTRSHCD
CDQEFYNCLKNVNTVVSNGIGFTYFTVLGPQCFRQDYPIIGCLKKDIRGRCLEYKTNETQ
EKIYEWFDNPQYV
Download sequence
Identical sequences C0LTQ4
TC013420 7070.C0LTQ4 NP_001139342.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]