SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC015482 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  TC015482
Domain Number - Region: 15-68
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.0102
Family Insect phospholipase A2 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC015482
Sequence length 432
Comment GLEAN_15482
Sequence
MLSFKGEGLLNTAINKLPFELHLPGYQYCGPGTKLKKRLERGDPGINKLDSFCKTHDIAY
ANSNDLKDRHQADRILEDSAWSRVKSKDASFGEKASAWFVTNAMKVKRKLENKGYDNIKS
ALSAARIAVRKSGGRKRIKIPRIIPIKTGRFLPLLPLIFGGLSALGTMGGGAAAITKTVN
DAKAAKQKLDENKRHNKVLEDIAIGVESTLSEHYEPPIDLEENSNYSIALIGSYTNNNIP
NIEEGTNKFYYLPPSTTEEKVITFPKSAYEIAAIEKYIQIILSGRSATDAQKQNTFSLKA
NENTLKCEIFSIYDINFAHEDSIGKLLGFSQRKLKARQLHESDLPVNIIKVNTIRIECNI
VRGSFYKNKESHTLYETALSVSPAEQIFVELLNPIYLPIINRSNIPNLTIDIVDLDHRPI
DFKHKQSIFVLL
Download sequence
Identical sequences D6WWU8
TC015482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]