SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC030643 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC030643
Domain Number 1 Region: 3-240
Classification Level Classification E-value
Superfamily CutC-like 6.54e-65
Family CutC-like 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC030643
Sequence length 242
Comment GLEAN_11753-OG17716
Sequence
MRVLEVCVDSYESAVAAMTGGAARLELCSSLVDGGLTPTPGLLAQIREYSKEITVFCMLR
CRPGNFVYTTEEVEIMKRDAKILQKYGSDGFVFGALNANGEVEMKQCREIIMACSPLPVT
FHRAFDVCKKPTIEIEVIIDLGFKRVLTSGQQKNAQLGAKLIKNLMEQVGDRICIVPGGG
ITKQNLGFIVEHTGAKEYHGSFKKAKEGEEKEKTAGEVEQERVLYVTDKDYVAEVVHILN
VA
Download sequence
Identical sequences D6WZX5
XP_974944.1.52716 TC030643 7070.XP_974944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]