SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for TC000268 from Tribolium castaneum 3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TC000268
Domain Number 1 Region: 283-378
Classification Level Classification E-value
Superfamily TAFH domain-like 2.75e-31
Family TAFH domain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 560-606
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000119
Family TBP-associated factors, TAFs 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TC000268
Sequence length 766
Comment GLEAN_00268
Sequence
MASAKFLEEALSTDVDESAVSAIVGSLENQLVTSSTTAPASAAQNHVNSAISNGGTVGPP
KHSTVANGDSISDAKSADAAPVKIVYSQAMAGAGTLLPNARVALPPNGTLPQAAPGKQPT
LVIKTCGASAPGLVTVPMNVTTSVPPANNVVNVRPGVPAQQQKGQPARVVLSAPQIVGAR
PGAPQLTLQTFHGLQPGQQGHLLLKTENGQYQLLRVGPPPATANLTATSTPGGQPVTLRM
QTVAAAPTSSATTSPAVAGGTTTVSSQGQTVQTVTTVQRPANDNTKEKCRKFLANLLELS
SKEPKSVERSVRTLIQELIDMKVEPEDFCDKLERLLNASPQPCLIGFLKKSLPLLRHSLV
TKELTIDGIRPPPANVVFSIASGSPTVQTQVRPGIASNQVRIVAPGTAVVRPGQVLQQRL
VTPLRGAAQQTPRMMTTIRQPNAAGNVIVSSSQPPALHPVYPSNQVRAGSNIRQPLQNKS
PMTSMKLQGIKPAVPSIVSRPTSKEKEKKSFSAAYTGDDDINDVAAMGGVNLAEETQKIL
GSTEFVGTQIRSCKEEIMCSMGPLQQKIRQIVMKHGLDEPSADVAACISHAAQERLKNLI
EKLAIITGHRLDIVKKDLRYEVTNDVKGQLKFLEEVDRAERKRHEELEREMLLRAAKSRS
KTEDPEQAKLKAKAREMQRVEMEELRQREANATALQAIGPRKKPRLEGDGQSSLSQGNAG
GFNSGLRGQMPLRQRMKKVTLRDLQFLFETEKDLCKSKLLYKSYLK
Download sequence
Identical sequences XP_008199889.1.52716 TC000268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]