SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|57640363|ref|YP_182841.1| from Thermococcus kodakarensis KOD1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|57640363|ref|YP_182841.1|
Domain Number 1 Region: 193-360
Classification Level Classification E-value
Superfamily RibA-like 4.05e-60
Family RibA-like 0.00000467
Further Details:      
 
Domain Number 2 Region: 2-185
Classification Level Classification E-value
Superfamily YrdC/RibB 5.72e-45
Family 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|57640363|ref|YP_182841.1|
Sequence length 386
Comment bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein [Thermococcus kodakarensis KOD1]
Sequence
MNWDRVRGLVLEGKPVVLIDNRREFEADLIYPAEIASPEIVNFMLSMKGLLCLTMDMDEA
LKRGFFPLPSKEGETNFLVPVDYKETFTGITAEERALTARKIAEGLGVGAFRYPGHLHLL
GGIGLNRRRGHTESSLELMEILGFKRYALMVEILDEKGDSHNREYALKLAEEHGLPVLTT
DDVWKEFVRRKQLMRIYASARLPTRYGDFRIIAFDNELDFKEHVAIVKEPYGEVPLVRVH
SKCLTGDTFASLKCDCGSQLANALRMIAQEGGILLYMDQEGRGIGLKEKIKAYELQDKGF
DTVEANKALGRGEDERTYEAAFQMLRALGVSKIRLITNNPRKAKALEEFGIEVVETVPAP
GEVTEHNKPYLKVKAEKLGHKLPFKV
Download sequence
Identical sequences Q5JD32
WP_011249383.1.23727 gi|57640363|ref|YP_182841.1| 69014.TK0428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]