SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|57640867|ref|YP_183345.1| from Thermococcus kodakarensis KOD1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|57640867|ref|YP_183345.1|
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily Transposase IS200-like 3.14e-42
Family Transposase IS200-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|57640867|ref|YP_183345.1|
Sequence length 136
Comment IS200-like transposase [Thermococcus kodakarensis KOD1]
Sequence
MKYKLDKGAHSVYSLYYHLILVVKHRRKVFTNDRIIDFLKQKIHEISETHEVEVLTIETD
QDHVHILFKAKPTLNIPKYINALKTITSREIRRNFPEVKEKLWRNTFWSPSYFLATSGQV
TLDVLKAYVESQGEGS
Download sequence
Identical sequences Q5JI87
gi|57640867|ref|YP_183345.1| WP_011249883.1.23727 69014.TK0932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]