SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|57641247|ref|YP_183725.1| from Thermococcus kodakarensis KOD1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|57641247|ref|YP_183725.1|
Domain Number 1 Region: 253-389
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.57e-19
Family MJ1460-like 0.015
Further Details:      
 
Domain Number 2 Region: 2-201
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.51e-16
Family RecA protein-like (ATPase-domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|57641247|ref|YP_183725.1|
Sequence length 394
Comment hypothetical protein TK1312 [Thermococcus kodakarensis KOD1]
Sequence
MLKTGIRQVDDALDGGIIESSAVAFVGSLEYDNIILMHQVALNALKDGKKVLLVAFREAP
DTLIKEAEHNGINYLPFIENGSLVILDGYTNLYAPDQKQGENILSNPLDIGITTAVIRDR
LSKGDFDVLVVDDLTAQYTLQPNPKGYIKTLVRLINSVKSTGVTAMAALCGNVFEKVDLA
ATLIPFDYVFEVSRGRIHIARSIQPLKTANLIFPYVRSSEGIKLVLEEYATLEGIKKRLR
AESDGTLWLDWDRVEIITEDSERATIETAYEFLGPEKGKEFLYLWGKKQFIGLGKDARMR
TDSLRAALEEIALLTRSSGGGTLEIVDIKDDLILITGKNLFPGGKGSSLPYHVHYAGSIA
QFLTEFTGKRWEGKETKCEAMGADHCEFVFWPVE
Download sequence
Identical sequences Q5JGR2
69014.TK1312 WP_011250263.1.23727 gi|57641247|ref|YP_183725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]