SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|57641690|ref|YP_184168.1| from Thermococcus kodakarensis KOD1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|57641690|ref|YP_184168.1|
Domain Number 1 Region: 2-325
Classification Level Classification E-value
Superfamily SIS domain 8.9e-63
Family double-SIS domain 0.0000744
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|57641690|ref|YP_184168.1|
Sequence length 326
Comment glucosamine-6-phosphate deaminase [Thermococcus kodakarensis KOD1]
Sequence
MHATLREIKRTPEGIKTAQRAFEEFVTNSDFLLPREVVYTGCGSSHFLSQPLAMATTRLG
GRGVALPCSELLYSREYYPVGKPELLVSISRSGETTEAVKALESLDVPKFALTAYESTLS
RKADYALIVPTHEESVVMTHSFTAFYFAFLQLLNASFGLETYDAEMTSELTREALKNEGY
IREITGEFDFRNVIFLGSGILYPIALEAMLKMKEMALFWSEAYQTFEVRHGFKSVADEGT
LVVLLVNEPFDWHEKLTKEFQGQGARVLTIGNGDTGADYFIDLPKVDELLTPILHLPIIQ
LLSYYKAIKRGLNPDQPRFLSKVVKW
Download sequence
Identical sequences Q5JDU3
69014.TK1755 gi|57641690|ref|YP_184168.1| WP_011250706.1.23727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]