SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|525908277|ref|YP_008292291.1| from Spiroplasma diminutum CUAS-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525908277|ref|YP_008292291.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.57e-27
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|525908277|ref|YP_008292291.1|
Sequence length 105
Comment PTS system cellobiose-specific IIA component [Spiroplasma diminutum CUAS-1]
Sequence
MNEINWENISMEMISCIGTSKSNAIMAIRAAKNQDFVKAKDLILEAEIEMSKAHNLHFDI
VSREANGEKLDLKLLFLHAEDQMLTTQAMIDLGKEMIEMYKIIYK
Download sequence
Identical sequences S5LZ93
WP_020836129.1.67789 gi|525908277|ref|YP_008292291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]