SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15643585|ref|NP_228631.1| from Thermotoga maritima MSB8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15643585|ref|NP_228631.1|
Domain Number 1 Region: 200-394
Classification Level Classification E-value
Superfamily PheT/TilS domain 9.15e-67
Family B3/B4 domain of PheRS, PheT 0.00000771
Further Details:      
 
Domain Number 2 Region: 463-681
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.94e-51
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000985
Further Details:      
 
Domain Number 3 Region: 44-190
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.71e-34
Family Myf domain 0.0034
Further Details:      
 
Domain Number 4 Region: 689-787
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.22e-28
Family Anticodon-binding domain of PheRS 0.00062
Further Details:      
 
Domain Number 5 Region: 401-471
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000412
Family Domains B1 and B5 of PheRS-beta, PheT 0.0019
Further Details:      
 
Weak hits

Sequence:  gi|15643585|ref|NP_228631.1|
Domain Number - Region: 9-48
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0589
Family KorB DNA-binding domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15643585|ref|NP_228631.1|
Sequence length 788
Comment phenylalanyl-tRNA synthetase subunit beta [Thermotoga maritima MSB8]
Sequence
MRVPESWLREFVDLDWDIEQIAERLTFSGTSVEDILRPFNVSGEIITARVIERFDHPASE
KLIVCKVDTGKRIYTVITADKTVNEGDYVILALEGATLNNGLKIEPREFKGVISEGMLCS
LEELGLEEKSDRVYRFPDPVELGVNVVEEYGLNERVLDIEITPNRPDCLSIIGVARELSA
LSGRPLNKPQPDVSFVDEDVQFDVEIEDVEGCPRYSARIMKGVTVKDSPLWMKARLVAAG
VRSLNNVVDATNYVMIELGHPVHAFDLNRLKNKRIVVKSAKGGERVLLLDEKEYELKGGE
VLITDGENVLALGGIMGGMESGVYDDTRDLVLEVAYFDPVRIRKAAKALGISSESSYRFE
RGVDPNDVELVSLRLAELIQKLAGGYVLRKFWDVYPRKIEPKKVMLRKARIEKILGTKVE
EPGDILRRLEFQVEDRGDSYEVLVPTFRPDVEREIDLIEEIGRIYGYEKVESKVISVPAV
NRGWGEKQLFRREISQFMKGMGFDEVVTFSFVDSQKVKKWPLVDREPIALSNPIASDMDV
MRTSQFYSLIQVLAENFKRQNRDLKLFEIGKIYFKENGNFREIETLSAMSCGLENPGDYT
DKRSVSFYTIKGVLDELFFRLGVNVVYRAAEIPGLFPTRSARIYVENREIGFIGMVDPKL
LDEYDVKEDTYFFEIDMELLRKYASKRPAYRPTPRFPAVRRDISFLLPKGFESVKIIELF
KKSGGDLVEEVGVFDIYEGKGIPENMVSVTLYVVFRHPERTLTDEEVNKIFEEMVQKAER
EFGIRRRF
Download sequence
Identical sequences G4FD02 Q9WZS9
282692 NP_228631.1.35502 WP_004080832.1.29620 WP_004080832.1.45724 WP_004080832.1.51363 WP_004080832.1.56403 WP_004080832.1.79805 gi|15643585|ref|NP_228631.1| 243274.TM0822 gi|15643585|ref|NP_228631.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]