SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15644463|ref|NP_229515.1| from Thermotoga maritima MSB8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15644463|ref|NP_229515.1|
Domain Number 1 Region: 31-84
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000693
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|15644463|ref|NP_229515.1|
Domain Number - Region: 152-193
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00654
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15644463|ref|NP_229515.1|
Sequence length 204
Comment hypothetical protein TM1716 [Thermotoga maritima MSB8]
Sequence
MRVFLGIIIGIVVGGLFFLFTMKFYQSQYSTVPDVVGLSGTEACERLKTSGLFCDKSSSE
TVVDTYPRAGSRVKKGRTVNLYYENPQKKIVPRLSQLNFPVAEEILKRLGWNYETVYFPF
GTEKDRVLATYPKEGQIYNGKLILLIDTGEKESYFLVENFVGKKVDELKDDPRVLLLGTG
DTVVAQYPPEGSIATKVILILGEE
Download sequence
Identical sequences Q9X241 R4P429
gi|15644463|ref|NP_229515.1| 243274.TM1716 NP_229515.1.35502 WP_004082232.1.29620 WP_004082232.1.45724 WP_004082232.1.51363 WP_004082232.1.56403 WP_004082232.1.79805 gi|15644463|ref|NP_229515.1| 283572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]