SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000464 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000464
Domain Number 1 Region: 13-243
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.73e-78
Family Calponin-homology domain, CH-domain 0.000078
Further Details:      
 
Domain Number 2 Region: 1314-1428
Classification Level Classification E-value
Superfamily E set domains 5.07e-37
Family Filamin repeat (rod domain) 0.0000137
Further Details:      
 
Domain Number 3 Region: 1504-1617
Classification Level Classification E-value
Superfamily E set domains 1.27e-32
Family Filamin repeat (rod domain) 0.0000124
Further Details:      
 
Domain Number 4 Region: 1046-1137
Classification Level Classification E-value
Superfamily E set domains 2.94e-31
Family Filamin repeat (rod domain) 0.0000108
Further Details:      
 
Domain Number 5 Region: 446-554
Classification Level Classification E-value
Superfamily E set domains 8.01e-31
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 6 Region: 1427-1536
Classification Level Classification E-value
Superfamily E set domains 9.34e-31
Family Filamin repeat (rod domain) 0.0000274
Further Details:      
 
Domain Number 7 Region: 1821-1916
Classification Level Classification E-value
Superfamily E set domains 9.34e-30
Family Filamin repeat (rod domain) 0.00000956
Further Details:      
 
Domain Number 8 Region: 1225-1335
Classification Level Classification E-value
Superfamily E set domains 8.01e-29
Family Filamin repeat (rod domain) 0.0000234
Further Details:      
 
Domain Number 9 Region: 652-748
Classification Level Classification E-value
Superfamily E set domains 1.27e-27
Family Filamin repeat (rod domain) 0.00053
Further Details:      
 
Domain Number 10 Region: 736-853
Classification Level Classification E-value
Superfamily E set domains 4.07e-27
Family Filamin repeat (rod domain) 0.00069
Further Details:      
 
Domain Number 11 Region: 2007-2100
Classification Level Classification E-value
Superfamily E set domains 5.37e-27
Family Filamin repeat (rod domain) 0.0000402
Further Details:      
 
Domain Number 12 Region: 842-952
Classification Level Classification E-value
Superfamily E set domains 5.54e-27
Family Filamin repeat (rod domain) 0.00076
Further Details:      
 
Domain Number 13 Region: 1140-1248
Classification Level Classification E-value
Superfamily E set domains 2e-26
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 14 Region: 261-356
Classification Level Classification E-value
Superfamily E set domains 3.67e-26
Family Filamin repeat (rod domain) 0.00069
Further Details:      
 
Domain Number 15 Region: 1608-1714
Classification Level Classification E-value
Superfamily E set domains 4.27e-26
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 16 Region: 347-456
Classification Level Classification E-value
Superfamily E set domains 7.34e-26
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 17 Region: 2199-2289
Classification Level Classification E-value
Superfamily E set domains 8.01e-26
Family Filamin repeat (rod domain) 0.00000824
Further Details:      
 
Domain Number 18 Region: 550-647
Classification Level Classification E-value
Superfamily E set domains 1.07e-24
Family Filamin repeat (rod domain) 0.00018
Further Details:      
 
Domain Number 19 Region: 2390-2481
Classification Level Classification E-value
Superfamily E set domains 8.67e-24
Family Filamin repeat (rod domain) 0.00000996
Further Details:      
 
Domain Number 20 Region: 2519-2608
Classification Level Classification E-value
Superfamily E set domains 2.07e-23
Family Filamin repeat (rod domain) 0.0000118
Further Details:      
 
Domain Number 21 Region: 2131-2213
Classification Level Classification E-value
Superfamily E set domains 1.53e-22
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 22 Region: 940-1043
Classification Level Classification E-value
Superfamily E set domains 4.47e-22
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 23 Region: 2297-2386
Classification Level Classification E-value
Superfamily E set domains 2.67e-21
Family Filamin repeat (rod domain) 0.0000151
Further Details:      
 
Domain Number 24 Region: 1923-2003
Classification Level Classification E-value
Superfamily E set domains 9.34e-17
Family Filamin repeat (rod domain) 0.0000688
Further Details:      
 
Domain Number 25 Region: 1752-1836
Classification Level Classification E-value
Superfamily E set domains 1.33e-16
Family Filamin repeat (rod domain) 0.00009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000464   Gene: ENSTNIG00000016020   Transcript: ENSTNIT00000001433
Sequence length 2610
Comment pep:known_by_projection chromosome:TETRAODON8:13:10415561:10434204:1 gene:ENSTNIG00000016020 transcript:ENSTNIT00000001433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEEDDEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKTISDLQREFTDGLKLISLL
EVLSQKKMYRKYHTRPNFRQMKLENVSVALEFLERERIKLVSIDSKAIVDGNLKLILGLI
WTLILHYSISMPMWDDEDDEETKKLTPKQRLLGWIQNKVPQLPINNFNRDWQDGKALGAL
VDNCAPGLCPDWAEWDPNEPVQNAREAMQQADDWLGVPQVIAPEEIVDPDVDEHSVMTYL
SQFPKAKLKPGAPLRPKQLFPNKVKAYGPGIEPHGNKVLQPAVFTVDTLEAGSGEVLVYV
EDPEGHTEEAKVKPNKDKSRTYTVTYVPKVEGVHKVKVLFAGQDIDKSPYTVNVAKAMGD
PSKVHARGPGLDPVGNVANKPTYFDIYTAGAGNGDISVVIIDPGKKDTVELILENKGESV
FRCTYRPVLEGPHTIHVLFAEQEIPKSPYTVNIAEAVNPNACRATGRGLQPKGVRVKEVA
DFKVFTKGAGSGELKVSVKGPTGAEEQVKVQDAGNAVYNCEYYPLKPGKYTVSITWGGHP
IPRSPFEVEVGGEAGVQKVRAWGPGLKTGMVGKSADFVVEAIGVDVGTLGFSIEGPSQAK
IECDDKDDGSCDVHYWPTEPGDYAVHVICDDEDIKDSPFIAHILPAANDTFPEKVKAYGP
GLKPTGVIVNKPTEFTIDARLAGKGHLTIYAQDAEGCTINIEIADKGDGTYLCVYTPVKP
IKHTIIITWGEVNVPNSPFRVLVGEGSHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAG
QALGDISIGIKCAPGVVGPGEADIDFDIIKNDNDTFTVKYTPPAPGRYTIMVLFAEQEIP
ISPFKVKVDPSHDAGKVRAEGPGLNKTGVEVGTPTHFTIYTKGAGKAKPEVHFAASRPGE
AVRDFEIIDNHDYSYTVKYTALQQGNMSISVTHGGDPIPKSPFHITVAPPLDIGKVKVEG
LDNKVEVGKDQEFTVNTKGAGGQGNVGVKMTSPSGRPIPCKLESDKAKGIHSVKYIPPEE
GHYKVDVSYDGNPVMGSPFGVEAVMPADPSKVRAFGPGLQGGIVGKPAPFTIDTKGAGAG
GLGLTVEGPCEAKIECQDNGDGSCSVYYLPTEPGEYAINILFADQHIPGSPFKAPVRMAL
DPSKVTASGPGLERAKAGEPATFTVDCTRAGDAELTIEIVSETGAKAEVHIQKTAQGIFS
VTYIPPFHGAHTITIKYGGHMIPHFPKVLQVDPSVDTSGVHVYGPGVEPRGVLRDVTTHF
IVDARALKKAGGNHVKVHVINPSGTKTESYLTDKGDGTYRVEYTAFEDGIHLIEVLYDDV
PVPKSPFRVSVVEGCDPSRVRAFGPGLEGGITNKPNCFTVETRGAGTGGLGLTIEGASEA
KISCKDNKDGSCSVEYIPFTPGDYDVNITYGGHPIPGSPFQVPVKDPVDPSKVKCSGPGL
GTGVRAHVPQTFTVDCTKAGQAPLDVKLYGPTGTAEPVGVKNNGDGTHTVHYTPAQDGPY
TVAVKYAEQEVPHSPFKVMSQPGHDASKVRASGPGLDTKGVSASLPVEFTIDARDAGEGL
LTVQILDPEGKPKNATIQDNRDGTYTVSYVPDSTGPYTITIKYGGDEIPYSPYRIQSLPT
GDASKCLLTAANLQKLQTSEDTVITVDAKAAGKGKVTCKVQTPQGMELDMDVVENHDGTF
DIYYTAPEPGKYVITIRFGGQNIPKSPFHVVVGKKSIYLADVCVCVCSVVSFYATNEPVV
PRDTVDPLFRPVNFLVPFTPQQGEITGEVRMPSGKTARPHITDNKDGTITIKYQPTERGL
HEMDIKYEGNQIPGSPLQFFVDAVNTGVVTAYGPGLSYGTVNKAATFTVVTKNAGEGGLS
LAVEGPSKAEITCKDNKDGTCLVSYLPTAPGDYNIIVKFDNKHIPGSPFTAKITGDDTIT
RTSQLNVGTSADVSLKIAETDLSSLTASIRAPSGNEEPCLLKKLPNRHLGISFTPKEVGE
HEVSVRKNGVHVANSPFKIMVGQSEIGEASRVKAFGKGLVEAHTSEMAEFFVDTRNAGYG
GLALSIEGPSKVDINCEDMEDRTCKVTYCPTEPGNYNVNIKFAEKHIPGSPFTVKVTGEG
RIRESITRKRQASSLASVGSTCGLNLKIPVECGPQTMTAQVTSPSGKTVDADIVDGGNST
YSVRFIPQEMGPHTVNVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAAAPS
EFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSCGVSYIVKEPGDYEVSIKFNNEHIP
DSPFIVPIATLSDEARRLTVTSLQEKDLKVNQEASFMVQRNGARGVVDAKVHTPSGSSEE
CYVTELDSDKNAIRFIPRENGVHSIDVKFNGCHIPGSPFNVRVGDPGLIGDPGMVTAHGA
GLQGGITGAPSEFVVKTCNAGSGTLSVNIDGPSKVKLDCRECPEGYKITYTPMAPGNYLI
AIKYGGPQHIVGSPFKAKITGARLSGGHSLHETSSVLVETVTKTAKSASSSSSTTLTSDA
SKVVCRGTGLTKALVGQKNNFTVDCSKAGTNMLMVGVHGPHTPCEEVYVKHMGNKLYNVT
YAIKDKGSYQIIVKWGDDNVPGSPYKVVAP
Download sequence
Identical sequences H3BWV1
ENSTNIP00000000464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]