SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000655 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000655
Domain Number 1 Region: 1175-1210,1287-1450
Classification Level Classification E-value
Superfamily NHL repeat 0.0000000000706
Family NHL repeat 0.0088
Further Details:      
 
Domain Number 2 Region: 591-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000512
Family EGF-type module 0.052
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000655
Domain Number - Region: 721-746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000205
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 691-715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00102
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 624-649
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0014
Family Integrin beta EGF-like domains 0.086
Further Details:      
 
Domain Number - Region: 557-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.004
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 750-783
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0395
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Domain Number - Region: 658-684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0828
Family Integrin beta EGF-like domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000655   Gene: ENSTNIG00000019040   Transcript: ENSTNIT00000001589
Sequence length 2695
Comment pep:known_by_projection chromosome:TETRAODON8:16:5682465:5751760:-1 gene:ENSTNIG00000019040 transcript:ENSTNIT00000001589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVKERRPYRSLTARQDTEHRYTSSSADSEDGKANPKSYSSSETLKAFDHDSRMAYGSRV
KEMVHHEVDEFSRQGVDFSLRNLGFGEALPSHVATYRSDMGLPHRDYSVSAGSDPDTETD
GIMSPEHAVRLWGRSNTKSGRSSCLSSRANSNLTLTDTEHENTENEGSEKETPSSNNHSR
LRTPPLPLSHSHSPSHQHHAASINSLNRSNYTQRSNPSPAPTDSSVPPEGPASQDSVSVQ
DNWLLNSNIPLETRQFLFKPGGTSPMYCTTSPGYPLTSSTVYSPPPRPLPRNTFSRPAFS
LKKPYKHCNWKCAALSAILISVMLLFLLAYFIAMHLFGLNWHLQPVQRQMYQLSEDNTSG
LPFPTDLSVSPVGNTGLVIPERRDDSYIDMGEIDVGRKVTQQIPPGVFWRSQVFIDHPMY
VKFNVSLSKDALVGIYGRRGLPPSHTQQFDFVELLDGRRLLVQDIRGVEGPAAMQRGLIP
ITTHDTGFIQYMDSGIWHLAIYNDGKETETVSFLTTATDSIDDCPSNCFMNGDCIAGKCH
CFLGFKGPDCGRAACPVLCSGNGQYLKGRCMCHSGWKGSECDVPTNQCIDIACSNHGTCI
VGTCICNPGYKGENCEEVDCMDPTCSGRGVCVQGECHCFVGWGGSGCESPRASCMDQCSG
HGAFLADTGTCSCDPNWTGHDCSTEICAADCGGHGVCVSGSCRCDDGWMGSGCDQRACHP
RCNEHGTCKDGKCECSPGWNGEHCTIEGCPGLCNGNGRCTLGNNGWYCVCQLGWRGTGCD
TSMETACTDVKDNDGDGLVDCMDPDCCLQATCHTTALCVGSPDPLDIIQETQLSSTQSKL
QTFYERVRFLVGRDSTHVIPGVNPFDGKVSSAVRQIVREDDSPSLKRFSFLMFPFSLSLF
IFNHFFDLVTNGGIAVALHFERAPFITQEHTLWLPWGRFFVMDTIVMRHEENDIPSCDVS
SFSRPSPLVSPASLTAFAGSCSERRSVVPEIQEEESANTQESDMKFSYLSSRTAGYKSLL
RVTLTHSTIPFNLMKVHLMVAVEGRLFRKWFPAAPNLSYDFVWDKADVYSQKVYGLSEVF
VSVGFEYESCPDFILWEKRAAVLQGYETTASKLGGWTVDKHHALNIQSGILHMGNGENVF
ISQQPPVIGSVMGNGRRRSISCPSCNGLADGNKLLAPVALACGSDGSLYVGDFNYVRRIF
TTGNVTSVLELRTLSADGPAHRFEPTEMSLCSTESDLQSMLKPANLSLNAKAWKKNIEEI
VIGFAHPCLLLNTWWCQNGEHSLKQASVLSAGITVDKYGVIFFVDGTMIRRIDQNGIIST
LLGFNDLTSARPLSCDAVMDISQVRLEWPTDLAVSPLDNSLYVLDNNVVLQISENHQVRI
VAGRPIHCQVPGIDHFIMSKVAIHATLESANALAVSHTGILYIAESDEKKINRVRQVSTN
GEIFLVAGAPSGCDCGQELAVMTYHGSSGLLATKTNENGWTTFYDTIGSYSVPRENMLNG
YHSKRLSDAVFNLSRSPSPVFELESVAFLKGLLSVLACVFLTIVSEVSGTFGKPGKCSSE
LPAPLVTPLSNENQLIGRNIGSQKYLRVFCAEEIIRFFFSSGSFVMCVSFNISLMLTSCY
KVYDSYGRLTNVTYPTGQVSSYRTDADSSVRIQTEGSNKENITVTTNLSASGTFYTLMQD
QVRNSYFIGLDGSLRLVLANGMEVSLHTEPHLLAGTIIPTVSKRNITLAIDNGLNLVEWR
QRKEQARGQVTVYGRRLRVHNRNLLSLDFDRITRTEKVYDDHRKFTLRIHYDHAGRPTLW
APSSRLNGVNVTYSPGGNVAGIQRGTMSVRMEYDQTGRITSQIFADGKSWTYTYLEKSMV
LLLYSQRQYIFEFDKNDRLSSVTMPNVARHTLETSRSIGYYRTTYQPPEGNASVLQDYSE
EGQLLQTTYLGTGRRVTYKYGKIAKLLEMLYDTTRIGFYYDELTGMLKTVNLQSEGFTCT
VRYRQIGPLIDRQIFRFSEEGMVNARLDYVYDNSFRVTSMQAVINETPLPIDLYRYDDVS
GKTEQFGKFGVIYYDINQIITTAVMTHTKHFDAYGRVKEVQYEIFRSLMYWMMVQYDNMG
RVVAKELKVGPYANTTRYTYEYDADGQLQVVSINDKPLWRYSYDLNGNLHLLSPGNSARL
TPLRYDNRDRITRLGDVQYRMDEDGFLKQRGNDYFEYNSAGLLVRVYNKVSGWSIQYRYD
GLGRRVSSRSSIGHHLQFFYADLSSPTRITHMYNHSSSEIASLYYDLQGHLFAMELSSGD
EFYVACDNIGTPLAVFSGAGIMIKQILHTAFGEVYLDTNPSFQLIIGYQGGLYEPLSRLV
HMGKRDYDVLAGRWTTPNLEIWKRLNSKHIAPFNMYMFKNNNPLSNNEEIKCYMTDVNSW
LVTFGFQLYNVIPGYHKPNTESMEPSYELVRTQIKTQEWDSTKSLLGVQCEVQRQLKAFV
KLERFGQIYGAKSAGCPQTETKHIFATMGSIFGKGVKFAIREGRVSTDIISLANEDGRRM
AAVLNDAFYLEHLHFTVAGMDTHYFVKMGPVEGDLSLIGMTVGQRTLETGVNVTVSQVNA
VLNGRTRRITDIQLQYGTLYLNTRYGSSVDEEKARILEMARQRAVTQAWARERQRLRDGE
EGSRTWTEGEKQQLLGSGKVQGYDGYYVVSVDQYPELADSVNNIHFMRQTEMGRR
Download sequence
Identical sequences H3BXE2
ENSTNIP00000000655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]