SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000824 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000824
Domain Number 1 Region: 153-341
Classification Level Classification E-value
Superfamily E set domains 2.75e-55
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000431
Further Details:      
 
Domain Number 2 Region: 50-167
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.01e-20
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000824   Gene: ENSTNIG00000001554   Transcript: ENSTNIT00000003133
Sequence length 382
Comment pep:known_by_projection chromosome:TETRAODON8:3:10881658:10884291:1 gene:ENSTNIG00000001554 transcript:ENSTNIT00000003133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEETGERAITDTHSTTVHCLSSQDESRRLRYMQKDGRFPVVFQKAPGQWSPYLTDIFTT
LVELRWRMVFLFFLLSYILSWLFFGLIYWLIAYVNGDIDGEESRLCVANVRGFTGAFLFS
TETQATIGYGFRTMTENCMGAIIVVTIQDLFSCLLDTIIIGIIIAKMASARKRAVTVGFS
RCAVINLRNGCLCLAWRLGDLRGNHILEGVVKATVVRYVRKPQGAIVMSYQDLDIPNREI
VLATPATVIHRIDPSSPLYGLGPEDLLGNHFEMVVSFTYTGDSTGLLHQTRTSYTPTDIH
WGQRFQDVMKLHKGRYKVDYSLFNATVWVPVPLLSAKEFGRRRRPVVASQNPQLSFSLES
PSEHNLQENLEDSTEATHQTYF
Download sequence
Identical sequences H3BXW1
99883.ENSTNIP00000000824 ENSTNIP00000000824 ENSTNIP00000000824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]