SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001173 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001173
Domain Number 1 Region: 4-115
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.84e-16
Family Tryptophan biosynthesis enzymes 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001173   Gene: ENSTNIG00000000956   Transcript: ENSTNIT00000002676
Sequence length 118
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:30132380:30134269:1 gene:ENSTNIG00000000956 transcript:ENSTNIT00000002676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFTDIKKKHSSHALTSDVSLEETARAAEFFLSDGVIVTGAATGAQADPEECRDVSQSVK
IPVLIGSGVTCDNLEAYIGANGMIIGSHFKEGGHWANAVDPQRVKRLMRKRSSLLNSL
Download sequence
Identical sequences H3BYV7
ENSTNIP00000001173 99883.ENSTNIP00000001173 ENSTNIP00000001173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]