SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001295 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001295
Domain Number 1 Region: 27-309
Classification Level Classification E-value
Superfamily L domain-like 6.46e-52
Family Internalin LRR domain 0.026
Further Details:      
 
Domain Number 2 Region: 421-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000231
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 485-553
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000424
Family Fibronectin type III 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001295   Gene: ENSTNIG00000001740   Transcript: ENSTNIT00000004213
Sequence length 624
Comment pep:known_by_projection chromosome:TETRAODON8:19:3633328:3636251:1 gene:ENSTNIG00000001740 transcript:ENSTNIT00000004213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRPLSSLSHVVLTRISCLCLLGRVPADCSCNGPGFIFCISRRASTVPRVPADTRNLYIFQ
NGIDTLSQDDFEGLGELELLDLSQNKLTEIPDDVFGMLSKMKNLDLSSNVITHIRKDSFS
GLVQLERLYLHGNLIQSIHAEAFEGLEMLLELKLQGNQLSSLPSLRFPRLLLLDLSNNNI
PSLGPSDFQTPHLEALKIVSLGLMSLGDELIASMRNLHELDISMNQLTEVPLALKQDSLK
GLIKLSLAGNPLGDLRVEDFEKLTSLQELDLSGLNLQGFSPSFLEMFPRLTQLTAAENPF
NCLCPLAWFPVWLKEKKVNLRRPEETRCHFPLVNAGKKLSALETRDFGCPLTTTLPIGSP
TGSTPSIPVSTTPPKMTYTNAIPPPPPPPSEEILPSKTPYPLPPEPTFSPSSTSGEVESH
ICPANICLNGGTCHFDPMGQLSCICLSGTSGLYCENVDIVPDPPKHPVTEATLAASSVPV
QNDAISSRQVTSTSILLDLQRFIETRPHIRGIRLIYRNLSGPDRRPMILSVPASYPEYTL
RGLKPNCTYSVCASPLGERVSLRANSSVDTGSCTEARTEGILMTSSSATAPTPGPMTFTL
ILAVSALALVLGVSLVAGTVICVR
Download sequence
Identical sequences H3BZ79
99883.ENSTNIP00000001295 ENSTNIP00000001295 ENSTNIP00000001295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]