SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001568 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001568
Domain Number 1 Region: 159-335
Classification Level Classification E-value
Superfamily E set domains 5.32e-25
Family Arrestin/Vps26-like 0.015
Further Details:      
 
Domain Number 2 Region: 18-141
Classification Level Classification E-value
Superfamily E set domains 2.66e-17
Family Arrestin/Vps26-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001568   Gene: ENSTNIG00000001081   Transcript: ENSTNIT00000002283
Sequence length 340
Comment pep:known_by_projection chromosome:TETRAODON8:12:2651678:2653812:-1 gene:ENSTNIG00000001081 transcript:ENSTNIT00000002283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPPCKSLKVTHNPINETDTFSNGDSVSGQVTLEVAKDCQISSLSVKFKGKARVLWSERHG
NTTVVYHSKEKYFTFKNYFIRDKKATGDNVVAPGCHVYPFTFQIPYQIMPPSFKGADGKI
VYSLEARLSRSMRIDQKDLTKINFVPNANWSPEHNLREPQHESKEKKMNLFTSGSVSMDV
SLEKTGFCQGEGISVLACIQNNSSREIKPKYCLYRKHSFFAEGKRRVHTKDLLKEVGNPI
PPSASEKVTRVITIPQDIEPSIFNCSIIKAEHRLRVYLDVKYASDPEIKFPIVILRAPTV
SAAPPFPTASAPYPAAAFGFGNTALPQPPPAPPNPFDPAP
Download sequence
Identical sequences H3C002
ENSTNIP00000001568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]