SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001601 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001601
Domain Number 1 Region: 554-614
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000162
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 23-70
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000011
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 483-528
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.00091
Further Details:      
 
Domain Number 4 Region: 608-665
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000162
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 5 Region: 76-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000103
Family LDL receptor-like module 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000001601
Domain Number - Region: 434-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000509
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001601   Gene: ENSTNIG00000005137   Transcript: ENSTNIT00000000526
Sequence length 810
Comment pep:known_by_projection chromosome:TETRAODON8:12:8686203:8697279:-1 gene:ENSTNIG00000005137 transcript:ENSTNIT00000000526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLVCVCCSGLVLICSPRLCNLGINCQWGPYGDWSECDGCTKSQTRSRVVAVYAQFGGNSC
PGGRTETRPCETTRGCPLEDGCGGRFRCRSGKCISQSLVCNGDQDCEGDGLDEHCPSDRF
IICTQSTLPPNVELLGLGFDVVSEQTRASVINTKSFGGQCRTIYSGVHQTIYRLPVSTLQ
YSFMVKVQNDFSDEMFSSKWHYAKSIVQRERASGTTTGYRNYDFRETEMQKLLVLKNEIE
VAQFQSNSPQYIPLSEELWKALVKLPSVYDYAAYRKVLERFGTHYLSEGSLGGTFKVVAK
IDEETQRYMRTESSEYNECEETKYWILFFSFTRKTCRSGSSNSRFSTGTRSGNHLSRVDV
VGGGVQHSAALSTMSLDDPNKNWEMYSNWADSVRSFPQVTKQKLRPLSELVKEVQCAGVK
KMYLRRAIEQYLSESDPCHCQPCRNNGLVFTDGNTCKCVCKPGTSGLACEQGTEIEGQQG
VIQGSWACWSTWSSCNGARRSRSRSCSNPAPQNGGQYCSGESTETSDCDEDELSYLKTME
PQCFDQTLPESHKCETPPPLINGYIMEPKDIYLVGSKVEYTCISGFHLGSSTIECTENKT
WSSRPGLCIRSACQLGSLAEGVMAYPINGAYSIGDTVTLSCPEGRQLLGESEITCDPSLN
FSPDPASISCSPVKRQQTLLPPEVQCQPGKKPSKGKCVCKMPFECRSSLEVCTTVAVTNR
PFLLTVCKMHALRCLGKRYLIAEDGVCEWPQHQTNECRCKDSADCSDPGVNVCVRVGADG
QNQTMSECEAGLKRCKGEQVSVVSILPCTG
Download sequence
Identical sequences H3C035
ENSTNIP00000001601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]