SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002435 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002435
Domain Number 1 Region: 243-434
Classification Level Classification E-value
Superfamily BRCA2 helical domain 1.19e-78
Family BRCA2 helical domain 0.000000813
Further Details:      
 
Domain Number 2 Region: 602-737
Classification Level Classification E-value
Superfamily BRCA2 tower domain 2.35e-56
Family BRCA2 tower domain 0.0000682
Further Details:      
 
Domain Number 3 Region: 435-571
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.22e-44
Family Single strand DNA-binding domain, SSB 0.000009
Further Details:      
 
Domain Number 4 Region: 822-941
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-36
Family Single strand DNA-binding domain, SSB 0.0003
Further Details:      
 
Domain Number 5 Region: 574-602,739-821
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.46e-32
Family Single strand DNA-binding domain, SSB 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002435   Gene: ENSTNIG00000016261   Transcript: ENSTNIT00000002963
Sequence length 941
Comment pep:known_by_projection chromosome:TETRAODON8:16:4700614:4705074:1 gene:ENSTNIG00000016261 transcript:ENSTNIT00000002963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSFSSDTPRKPKAGSLSSEFTDRFLAQEALDCTKALLEDERLVDDPHMTGECLHRCPQFS
LLVNLFVKPHTAVLIPEQPPLKRRLLEEFDRTDGSSRGSALNPEKCSPNGIMGDRRVFKC
SVSFQPNITTPHRICSQKAERPVSFLSRRSGTNYVETSLPNTTPTKVSALRDSNEARLQK
SNFIPPFIKNVKLDTPNSKTASTFVPPFKKSRNSSKTEEEEPKHHFIPPFTNPCATSSTK
KHTAGHLHNVELARDMQGMRIRKKKRQTILPLPGSLFLKKSSGVTRIPLKSAVNGKPPAR
YTPKQLYGLGVPLNVLEITSETAGSFRFSLQQFVKLESLTDKGGIQLADGGWLIPRNDGT
AGKEEFYRALCDTTGVDPKLISEEWVYNHYRWIVWKQASMERSFPEQLGSLCLTPEQVLL
QLKYRYDIEVDQSRRPALRKIMERDDTAAKTLILCVCGVVSRGSSPQKQGLGGVAAPSSD
PQVENPFAVVWLTDGWYSIKAQLDGPLTSMLNRGRLPVGGKLIIHGAQLVGSQDACSPLE
APESIMLKIFANSSRRARWDAKLGFYRDPRPFLLPVSSLYNSGGPVGCVDIIILRSYPTL
WMERKPEGGTVFRSGRAEEKEARRYNVHKEKAMEILFDKIQAEFEKEERDNRKPRSRRRT
IGDQDIKSLQDGEELYEAVGDDPAYLEAHLTEQQAETLQNYKRLLIEKKQAELQDRYRRA
VETAEDGTGSCPKRDVAPVWRLSIADFMEKPGSVYQLNIWRPPSELQSLLKEGCRYKVYN
LTTTDSKKQGGNTTVQLSGTKKTQFEDLQASEELLSTYFQPRVSATFIDLQDPEFHSLCG
EVDLTGYVISIIDGQGFSPAFYLTDGKQNFVKVRCFSSFAQSGLEDVIKPSVLLALSNLQ
LRGQATSPTPVLYAGDLTVFSTNPKEVHLQESFSQLKTLVQ
Download sequence
Identical sequences H3C2G7
ENSTNIP00000002435 ENSTNIP00000002435 99883.ENSTNIP00000002435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]