SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002960 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002960
Domain Number 1 Region: 88-316,397-542
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.6e-75
Family Amylase, catalytic domain 0.00022
Further Details:      
 
Domain Number 2 Region: 558-655
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 6.4e-27
Family alpha-Amylases, C-terminal beta-sheet domain 0.0048
Further Details:      
 
Domain Number 3 Region: 38-83
Classification Level Classification E-value
Superfamily E set domains 0.0000108
Family E-set domains of sugar-utilizing enzymes 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002960   Gene: ENSTNIG00000019028   Transcript: ENSTNIT00000000493
Sequence length 659
Comment pep:known_by_projection chromosome:TETRAODON8:16:5984614:6021183:-1 gene:ENSTNIG00000019028 transcript:ENSTNIT00000000493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYDLLQKVLFQLEEAEGGFDQFTRSYWSFGVQRLPDNSLFFKEWAPAAEALFLTGDFNGW
DKFSHPYSKRDFGKWELTLPPKHDMSPAVDHNSKLKVVVHTKQGERLYRISPWAKYVNRE
EKSIIYDWVHWDPPHPYVQIHPRPQKPSSLRIYEAHVGIASPEGKIASYTNFTTNVLPRI
KDLGYNCIQLMAIMEHAYYASFGYQVTSFFAASSRYGTPDELKQLIDVAHSMGIIVLLDV
VHSHASKNTEDGLNFFDGSDSCFFHSPPRGEHTLWDSRLFNYSSWEVLRFLLSNLRWWME
EYRFDGFRFDGVTSMLYHHHGIGVGFSGDYSEYFGLPRQVDSDLLFYSTLAQNCHCESTL
LPTTVARLLPLKQSPLRVSATNNTQTVLIFRVAFASERFWLWILKEFKDEDWDMGNIVYT
LTNRRYGEKCIAYAESHDQALVGDKSLAFWLMDKEMYTNMSSLIPMTPIIDRGMQLHKMI
RLLTHGLGGEGYLNFMGNEFGHPEWLDFPRKGNDQSYHYARRQFNLVDEDHLRYRQLYFF
DRDMNRTEDKYGWLAAPAAFVSAKHEEDKVIVFDRADVLFVFNFHPTKSFQDYRVAVEAP
GKYRIKLDSDDVQYGGHGRLDHHTDFFTEPKPFNGRANSMQVYIPCRTAIVLANEEIDY
Download sequence
Identical sequences H3C3Z1
99883.ENSTNIP00000002960 ENSTNIP00000022219 ENSTNIP00000002960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]