SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003343 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003343
Domain Number 1 Region: 214-252
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000106
Family Assembly domain of cartilage oligomeric matrix protein 0.0016
Further Details:      
 
Domain Number 2 Region: 47-195
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000211
Family Laminin G-like module 0.026
Further Details:      
 
Domain Number 3 Region: 265-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family EGF-type module 0.027
Further Details:      
 
Domain Number 4 Region: 355-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000644
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003343
Domain Number - Region: 402-444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00229
Family EGF-like domain of nidogen-1 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003343   Gene: ENSTNIG00000000659   Transcript: ENSTNIT00000001126
Sequence length 446
Comment pep:known_by_projection chromosome:TETRAODON8:12:2904086:2906523:1 gene:ENSTNIG00000000659 transcript:ENSTNIT00000001126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAGSFQSFGTVSLSLSPSPSSAVYDLLDSPDCLPDLLQGSLKNKGRDEAFLLSSFRLQSR
APTSLYSVVNPKDSSKYLELSVQAKLSKVTLRYQKIDGRFATTSFNAPLADGRDHHMMLH
ASGLQAVPPRLNIYIDCRLVHTMNDLPAAFWGSPAGSQHGGAQDPAHSRTVEDKLTDLKL
VVEDTVDNVATLQDCHMDQGQPLQLLGQNTGKKPNRLTELKSMFAEMKELLQQQIKETNF
LRNTIAECLACGKQCPGTVILNPTCPPGTCFRQSMCIPAESGGFRCGPCPDGYTGDGMRC
DDVDECQFSPCFLGVTCVNTAPGFRCGRCPLGYTGPELTGVGVSYAKSHKQACEDIDECL
GPPENGGCTANSHCYNTMGSFRCGDCKTGFTGDQVKGCQNSRLCPDGQPSPCDANAECIV
ERDGSISCVCGVGWAGNGYKCGKDTD
Download sequence
Identical sequences H3C524
ENSTNIP00000003343 99883.ENSTNIP00000003343 ENSTNIP00000003343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]