SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003494 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003494
Domain Number 1 Region: 259-430
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.77e-58
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000079
Further Details:      
 
Domain Number 2 Region: 430-563
Classification Level Classification E-value
Superfamily E set domains 2.61e-33
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003494   Gene: ENSTNIG00000012108   Transcript: ENSTNIT00000001061
Sequence length 1201
Comment pep:novel chromosome:TETRAODON8:13:4756335:4767203:1 gene:ENSTNIG00000012108 transcript:ENSTNIT00000001061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSDFVSLLSSDLDLNSPNSLYCKESVYDLLPKELQLRPSSTQTDPPTMSQTSGGEAGPP
PSAALASVYATADATSFTSNSSASSSLTMGVPSPIASTAPSDHLMVPQQGHSGGGGGAGA
SENTPSKRRPVLNISPPPEDLFDDSQMSFQEEPAVCAPVGADSEHSSSIWADDSVSNFSL
VSSVSYNDNTEVPRKSRKRTTRQRPGPKPAPEDSMDVFDADSAKAPHFVLSQLGTDKISP
ISSSHESGITVKGGSLSTQFPQRSDGKELKILIQPETQHRARYLTEGSRGSVKDRTQQGF
PTVKLEGVSEPVVLQVFVANDAGRVKPHGFYQACRVTGRNTTACKEVDIDGTTVIEIPLE
PSNDMTLAVDCVGILKLRNADVEARIGVAGSKKKSTRARLAFRVNIPEPDGSVLTLQVLS
SPLLCTQPAGLPEILKKSLHSCSVRGGEEVFIIGKNFLKGTKVIFQENIADDNSWQGEAK
IDMDYFHQNHLIVTVPPFHNQSVTSPVSVGIFVMTNAGRSNEAQTFTYVPDSVDNSESQA
VKTEEPSLLEPCIFDGQPKSISSEQSDCSSQSSKRQEDTPMEVSSNQTPTDIFKAPADPL
VSVQQTLELSSSPHTGAESFQNPLPLQPEDVELPQAPPVFPCLETLSIIQKQDLSPSTAF
PVSGDTTIPPVTPEVPQQFLRDPQESMTPDRSNSGGGVVVVSMPQLAAPPQPQAQQSQMS
LFPEEGVALERAVRELQAGQQLNSVLYSPTPSAESLQQHVQENMNSLRLGTADNSVLGTM
QIQQQLILQPQEVLNNIQLQEQQQQQNQLLNNLQHQNQALSNLQQQQQLQEQVLENLQQQ
LQAELLQPQMHSSSQVQQPVSLLQQAGDLLTIQTSFPTQPPSHTSPPQQLFQSPRSLAES
QVQAALLQNTLTVLASGSLASEPQSAGSALYLSPNPPLAFISAIETSSQPQPVAIFQNQP
QAQLSQMQQQSTPMEQQQSPQQNSQPPQLPMGQQSTLFQGIPNHLQVANPGSQSQLSQPQ
QTGLLLCTTELNPQALLFSTQTPGPSPAGGIGVGIPQPDPAEPMSFQDQSSSHNNPASTE
NQQQNLFQDQQPMQVGPGSGSLPSSQPVELFLPQTSLSGLQNNIDPQEMSSQPAAAGTTI
FVVQGGVGVVASPGQQPSDQLFQTNVGGSVAPQGQANLFVFSIQNDSPQLLNSSGPPLPA
Q
Download sequence
Identical sequences H3C5H5
ENSTNIP00000015072 ENSTNIP00000003494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]