SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003550 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000003550
Domain Number - Region: 39-158
Classification Level Classification E-value
Superfamily E set domains 0.00154
Family Arrestin/Vps26-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003550   Gene: ENSTNIG00000011629   Transcript: ENSTNIT00000002868
Sequence length 347
Comment pep:known_by_projection chromosome:TETRAODON8:7:1224579:1227084:-1 gene:ENSTNIG00000011629 transcript:ENSTNIT00000002868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIFGFGQSAEIDIVLNDAESRKKAEHKSEDGRKDRYFLFYDGETVSGKVNVTLKYPGKR
LEHNGIKIEFFGQIELYYDRGNHHEFVSLVKDLARPGELTQSQTFDFEFTHVEKPYESYT
GQNVRLRYVLRATVGRRLSDITKELDVVVHTLSSYPEINSSIKMEVGIEDCLHIEFEYNK
SKYHLKDVIVGKIYFVLVRIKIRHMEIDIIKRESTGSGPNVYHENETIAKYEIMDGAPVR
GESIPIRLFLAGYELTPTMKDINKKFTVRYYLNLVLIDEEDRRYFKQQEIILWRKGDVAR
KSMPHQAAVASQRFGDARQSEEAQHPEDQPEDTPTHLGAVQKNDGTE
Download sequence
Identical sequences H3C5N0
99883.ENSTNIP00000003550 ENSTNIP00000003550 ENSTNIP00000003550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]