SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004009 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004009
Domain Number 1 Region: 121-368
Classification Level Classification E-value
Superfamily vWA-like 1.22e-82
Family Integrin A (or I) domain 0.0000000102
Further Details:      
 
Domain Number 2 Region: 364-453
Classification Level Classification E-value
Superfamily Integrin domains 9.42e-29
Family Integrin domains 0.000026
Further Details:      
 
Domain Number 3 Region: 619-703
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.15e-23
Family Integrin beta tail domain 0.0000434
Further Details:      
 
Domain Number 4 Region: 14-71
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000131
Family Plexin repeat 0.00015
Further Details:      
 
Domain Number 5 Region: 577-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family Integrin beta EGF-like domains 0.00072
Further Details:      
 
Domain Number 6 Region: 535-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004009
Domain Number - Region: 498-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family Integrin beta EGF-like domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004009   Gene: ENSTNIG00000011722   Transcript: ENSTNIT00000003183
Sequence length 768
Comment pep:known_by_projection chromosome:TETRAODON8:3:13410257:13417455:1 gene:ENSTNIG00000011722 transcript:ENSTNIT00000003183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFILLLPRLRCVASNICTSRGVTTCQQCLAVHPSCAWCSQEDFGKGSSISRCDLKENLLK
EGCSQAAVEFPSSTLTVDQDAPLSDKASGVADDVIQVKPQKIRVTLRQGDAKRFTVYVKQ
VEDYPVDLYYLMDLSYSMKDDLSNLRTLGNKLADTMGRTTSKLRMGFGAFVDKTVSPYMY
TYPPLAVENPCYKDQVKCQAQFGFKHVLSLTEQVGRFTEEVEKQQVSKNRDAPEGGFDAV
MQAVVCKENVGWRADASHLLVFTTDAKTHIALDGRVAGIVQPNDGKCHLDYSNNYNQSTI
LDYPSLALMTEKMSENNINLIFAVTNYVVPLYKEYSKLIPGTTVGILSDDSGNVIELIKE
AYEKIRSKVQLELLGVPDELNLSFNATCQSGEVVPGLKSCSGLKIGDTVSFSIEAQLRRC
PKDKSRTFTIKPLGFKDSLEITVDFACSCNCEAGAQANSSLCSHGNGTYECGCQCHSGRL
GPRCECSVEDYSPSDDANCIDKADGPVCSGRGDCLCGQCSCHGNDFGQVWGKYCQCDDFN
CLRFRGELCSNHGKCSCGSCVCDAGWKGENCNCSTRTDTCMSSIGLLCSGRGNCECGVCQ
CTQPGAYGATCEKCPTCPDSCTIKKHCVECQHFKRGQYIEDNSCSRICKDEIKVVDEIGV
RDNNAVNCSYKDEDDCLVHFQYYEDESGKSILSVVKMLECPEGPNILVVLLAVAGAILLL
GLVGLLIWKLVITIHDRKEFAKFEEERARAKWDTGNNPLYKGATSTFT
Download sequence
Identical sequences H3C6Y8
ENSTNIP00000004009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]