SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005366 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005366
Domain Number 1 Region: 808-862
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000114
Family Laminin-type module 0.00016
Further Details:      
 
Domain Number 2 Region: 915-965
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000268
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 3 Region: 269-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000123
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 4 Region: 704-755
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000197
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 5 Region: 864-912
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Laminin-type module 0.00071
Further Details:      
 
Domain Number 6 Region: 425-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 7 Region: 378-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 753-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000753
Family Laminin-type module 0.00052
Further Details:      
 
Domain Number 9 Region: 963-1008
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000262
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 10 Region: 1023-1245
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000418
Family Tropomyosin 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005366
Domain Number - Region: 80-162
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00117
Family Galactose-binding domain 0.04
Further Details:      
 
Domain Number - Region: 667-706
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00246
Family EGF-type module 0.055
Further Details:      
 
Domain Number - Region: 323-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family Laminin-type module 0.033
Further Details:      
 
Domain Number - Region: 1260-1518
Classification Level Classification E-value
Superfamily Tropomyosin 0.0131
Family Tropomyosin 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005366   Gene: ENSTNIG00000002804   Transcript: ENSTNIT00000005512
Sequence length 1589
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:58831:75149:-1 gene:ENSTNIG00000002804 transcript:ENSTNIT00000005512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDVDFDPVRGGLGLGLVRAAMDECADDRGNPQRCMPEFVNAAFNVTVAATNTCGSPPEEY
CVQTGATGVTKSCHICDARDPRNHHSAAYLTDYNNQQDTTWWQSQTMLAGIQYPNSINLT
LHLGKAFDITYVRLKFHTSRPESFAIYKRSSQDGPWVPYQYYSGSCEKTYQKVNRGFIRT
GEDEQQAVCTDDFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQDWVTATDIRVTLNRL
NFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKDAGRLVCNCKHNTKGDDCGV
CKPFYNDRPWRRATENANECLPCSCNGKSSECFFDGELYRATGHGGHCRNADNTDGPNCE
RCRENHHRDLNGERCLACGCSAVGSESLQCDSRGVCTCKPGVTGDKCDRCQPGFHSLTEA
GCRPCACSPSGSTQECDVNTGQCRCKDNVEGFSCDRCKLGYFNLDPQNPLGCTACFCFHH
SSVCESADGFSVHTITSSFQRDNERWTAQQRDGSSVAVQWSPSKQEVFLTSEDYFPLYFL
APDKFLGNQMLSYGQNLSLSFRVDRRDTRLSAEDLVLEGAGMRVAVPLIAQGNAYPNENM
HTYVFRLHDSSDYPWRPTVSHADFQKLLHNLTAIMIRGTYSERSAGYLDDVSLVTARRAP
GVAARWVEQCTCPQGYQGQHCERCTVGYRRTRPELGAFSACEPCSCNGHSDSCNPDTGAC
DCQDNTAGLSCERCRDGFYGDASGGTAADCHPCPCPAGATCAVVLRSKEVVCTNCPAGTT
GKRCELCDDGFFGDPLGQSGPIRTCRACKCSENIDPNAVGNCDRETGKCLKCIYNTEGSF
CDRCKNGFYGNPLASNPADKCKPCSCSPLGTVGGQSSCSQVTGQCPCHPNVAGRDCGACQ
PGFFNLQSGTGCARCDCDPVGSTNGQCDIITGQCECQPGVAGLRCQRCELDFFGFSSSGC
KPCDCDPEGSAAAQCQEDGRCQCRPGFVGTRCDMCEENFFYNRSVPGCQQCPSCYSLVRD
KVNQQRQKLHELQTLIDNLSSGQDQVSDQAFEDRLQEAEKAILELLEEAQSSKDVDRALL
ERLNSINNTLTTQWNRLQNIQNTVDDTSNRAEQAQNRVQDAKSLIERAQRELDRAQEAVS
KVDIRPPSSAADPNNMTLLAEEARALADRHKMEADQIEKIAKDANDTSTRASKLLLKTLD
GEAKTSQEIDQLNRKYNEAKDLAKNLEKQASKVQAEAQEAGDEALKIFANLTSLPPFNTD
ALEEDASKIKKEAADLDKLIDKTEKDYSELRDDLKGKEQEVRKLLEKGKSEQQTADQLLA
RADAAKALAEEAAKKGQSTFREAESILEDLRDFDKRVSDNKTAAEEAMKKIPHINATIQA
ANEKTRQAEAELGNAAADALEAKTKAEEAQRIASNVQKASTKTKEDAERAFLDTSKLDGE
VGDMMDQLTAAEQELARKKAEADQDMMMASMASDNAKEAENNARKAKSAVKMVLNTITVL
LDQLGNIDRVDLSKLNEIDESLKNAKGKMADSDLDRKLAELNDMARSQEDMIVDYDRQIQ
EIHADIANLNDIKNTLPDGCFNTPSLERP
Download sequence
Identical sequences H3CAU4
ENSTNIP00000005366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]