SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006459 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006459
Domain Number 1 Region: 1012-1156
Classification Level Classification E-value
Superfamily FAS1 domain 4.84e-22
Family FAS1 domain 0.0052
Further Details:      
 
Domain Number 2 Region: 1482-1568
Classification Level Classification E-value
Superfamily C-type lectin-like 2.51e-20
Family Link domain 0.00098
Further Details:      
 
Domain Number 3 Region: 250-400
Classification Level Classification E-value
Superfamily FAS1 domain 5.89e-20
Family FAS1 domain 0.0074
Further Details:      
 
Domain Number 4 Region: 849-1002
Classification Level Classification E-value
Superfamily FAS1 domain 9.03e-20
Family FAS1 domain 0.0027
Further Details:      
 
Domain Number 5 Region: 1585-1745
Classification Level Classification E-value
Superfamily FAS1 domain 2.88e-19
Family FAS1 domain 0.0046
Further Details:      
 
Domain Number 6 Region: 406-517
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000262
Family FAS1 domain 0.0058
Further Details:      
 
Domain Number 7 Region: 744-801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000201
Family EGF-type module 0.04
Further Details:      
 
Domain Number 8 Region: 87-232
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000471
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 9 Region: 786-843
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000199
Family EGF-like domain of nidogen-1 0.086
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006459
Domain Number - Region: 1378-1414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.001
Family Merozoite surface protein 1 (MSP-1) 0.064
Further Details:      
 
Domain Number - Region: 1422-1458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00148
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 1466-1483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0861
Family EGF-type module 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006459   Gene: ENSTNIG00000003856   Transcript: ENSTNIT00000006609
Sequence length 1837
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:64047975:64068326:1 gene:ENSTNIG00000003856 transcript:ENSTNIT00000006609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCEGFYGPDCKPCIGGFQHPCYDRGKCLDGIGGNGSCSCQEAFKGVACHICVDPSKHGER
CDQDCSCVHGVCDNRPGSGGVCRRGSCLEGFSGDNCDRMAAPCNSDGLHEHCHIHAYCVY
AEPDTKCVCRDGYEGDGHSCSPVNLCLRGDRAGCDKNAECVYGGPGSVSCVCVEGWTGDG
KVCVEINNCQLESGGDCSPNADCNHLGPGQHECVCKLGYMGNGMVCDLLNPCFNKNGGCH
ALVTCQGGARVTCTCPEYAGDGTLCYGSLQDELDMNPKLYNFRSFTQKYRHFSDDLSGNL
TLLLPSADAMLSPGLTQSSFWRTRHHLPAFVRSHLVPGIYSIEDLDRLVGTKLGTMNPPT
VWEVSKCNGSLCVGHARILAPNLPALNGYIHIIDRSLTPPLSDLPPEPPTLLAFLNSSSN
FTLFRQHVLTYNLSGDLASSGFTLLLPTDAAVQKYLSGTNASKLDSSVVKYHVIPNELLF
PDLLWDGMVKRTMLGVDHQVQFHVNSINQMTVNNVPLDSFTETQYGVIVVLPQVLQVQRN
RCSKPFTVQARGRCTDCDGLPVCLFGYQPVRERFPANMRPNCNYRKRVGSMKKSVPGCTM
KCSRVLTDHSCCPGYYGHECFRCPGEVGRWCSGHGECQDGAQGTGECRCYEGFHGTACED
CEPGRYGTNCSSKCTCDHGKCADGLAGTGRCDCYKGWKGASCSVEIVDDACGGVCDDNAN
CVPGPQGSTATCACVAGYEGNGTHCKEVDPCSSSNGGCSEFAICTKLAPGERSCTCEEGY
TGDGTVCLEIDGCLVNNGGCARSAECIRTGPNTTACRCLLGFKGNGRFCFPINLCQQDNG
GCSKYARCEQIQPGQRNCSCFSGYRGDGFTCRGSTNREVSNQLENAFFRQMLLKANVQNL
LGSGPFTVFVPVERLDNQNAYEEWKDSARLQDLVRYHVVSCELLRLSDLKSTQRAVSTSG
YTLHFSQQQGSVWINNRSRIVQSDYITFDGVIHHVSALLTPYSLKEKPVQQPDKMNLTSA
AVFYGYTRFYKLIEEAGLLPALAMAVHQPFTMLWPTDEALGSLPPERQRWLSSPDHREEL
AAIIKAHIIRSTVLALSLAGPSSTFRTMHGSKLRFSCDRTLVGAVLVNDNAARMVDRYLT
FREGLAYGIDHLLEPPGLGAHCDTLENRTTSQGRCGLCQRISPCPFRHHDTGEWETCSIR
RSRGRSWTLDWYSYRHYPWLNMDGCRRVCRFPVWLQKCCKNHYGRDCQVCPGDVDNPCSN
HGNCSDGILGTGRCSCSKGFRGSSCNLCFPGYYGTNCTACDNCGKWGNCDDGVQGSGKCV
CRKGWAGDRCQLDLQSLPEECRQCGPLAECVPGVGCQCRPGFQGNGSSCVPELPPDLCSE
YNGGCHQNADCNQTALTVNCTCHFGYQGDGFFCEPINRCVEEANGGCSDFASCKFVGPNK
RDCECLPGYVGNGVQCLEKLVPPVDRCLEDNGGCDPVATCKDLHYHAKTAGVFHLQSPSG
KYMMNFSQADAACKKEGATLATFKQLGDAQQLGMHLCVAGWMEGGKVGYPTRLASLKWAR
TTWAWSLVPHREPVSQSSNLSLSLATDVSCLCPADYVADGAFCNGVLLNVLATKPNFSTF
YQLLLDYSGSSEGKELVDVLSHRTADVTLFVPHNAGFAQNQTLSGRDLEYHISASQNRWT
LEDFQKHQTMSTRLGPNLTISLGSNEVGHLSTPQPQLVNKRLVLDWDIPASNGIIHVLGA
PLTAPPPTTSPQASRDHRYSSGALSAFLVLLLLVGILAGVGFSLFKRKTDVFQFHYFRDQ
DQDQDQDQDQDQDQDGSGGGRPKPTLLSYPNPLYSSS
Download sequence
Identical sequences H3CDY5
ENSTNIP00000006458 ENSTNIP00000006459 99883.ENSTNIP00000006459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]