SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007102 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007102
Domain Number 1 Region: 3173-3436
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-50
Family YWTD domain 0.00000254
Further Details:      
 
Domain Number 2 Region: 1406-1669
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-50
Family YWTD domain 0.00000322
Further Details:      
 
Domain Number 3 Region: 364-626
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-44
Family YWTD domain 0.00000686
Further Details:      
 
Domain Number 4 Region: 2364-2620
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-44
Family YWTD domain 0.00000509
Further Details:      
 
Domain Number 5 Region: 4029-4298
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-42
Family YWTD domain 0.0000176
Further Details:      
 
Domain Number 6 Region: 681-931
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-40
Family YWTD domain 0.0000227
Further Details:      
 
Domain Number 7 Region: 1716-1973
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-39
Family YWTD domain 0.0000523
Further Details:      
 
Domain Number 8 Region: 2035-2306
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-37
Family YWTD domain 0.000023
Further Details:      
 
Domain Number 9 Region: 235-251,286-355,619-674
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000282
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 10 Region: 1992-2030,2316-2373,2618-2681
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000408
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 11 Region: 2708-2750
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000144
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 12 Region: 1075-1112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 13 Region: 2959-3002
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 14 Region: 3048-3165,3425-3492
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000251
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 15 Region: 1235-1276
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 16 Region: 3600-3639
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000445
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 17 Region: 1034-1071
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 18 Region: 2672-2711
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000103
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 19 Region: 991-1029
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 20 Region: 2831-2869
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 21 Region: 189-229
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 75-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 23 Region: 1-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 24 Region: 3558-3602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 25 Region: 155-195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 26 Region: 3000-3042
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 27 Region: 1116-1153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 28 Region: 2877-2913
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000772
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 29 Region: 3483-3519
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000105
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 3723-3766
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 31 Region: 3766-3807
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 32 Region: 3694-3727
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 33 Region: 3520-3562
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 34 Region: 2787-2833
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 35 Region: 1154-1192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000089
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 36 Region: 3813-3849
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 37 Region: 3899-3936
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 38 Region: 1323-1400,1662-1710
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000022
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 39 Region: 1199-1234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 40 Region: 3855-3893
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 41 Region: 39-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 42 Region: 1280-1316
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 43 Region: 121-152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 44 Region: 2917-2960
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000458
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 45 Region: 3654-3687
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 46 Region: 3980-4012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000217
Family EGF-type module 0.013
Further Details:      
 
Domain Number 47 Region: 2753-2793
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000089
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 48 Region: 3941-3981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000157
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 49 Region: 4355-4386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000233
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007102
Domain Number - Region: 949-996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000718
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 4301-4385
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.022
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007102   Gene: ENSTNIG00000004460   Transcript: ENSTNIT00000007259
Sequence length 4632
Comment pep:known_by_projection chromosome:TETRAODON8:2:13960262:13990144:1 gene:ENSTNIG00000004460 transcript:ENSTNIT00000007259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CESGQFRCGTGRCIPGDWRCDGTSDCVDDSDEHDCPQATCDDSHFRCLSDGECIPDVWVC
DDEEDCEDGSDERQQCPGRTCTSNQFSCSNGACVPGEYQCDHTEDCSDGSDERSCHYPVC
AQLRCASGACYNQTQRCDHIVDCRDGSDEANCSKHCSAGLFQCHNGMCVPRSYICDHDDD
CGDRSDELNCTYPTCKGNYFTCPSGRCIHQVWLCDGEEDCEDNADEKGCDNVPKECYPGE
WPCPSSGLCIPVHQLCDGRAHCPDGEDETNTTAGRNCSIWKCASLSCEHRCHASPDGGTC
SCPSGYVVSSNNSRSCIDFDDCSMWGVCDQLCEDRTGSHRCSCREGYTLEQHRYCRADPS
AGIPSLIFSNGRDLLIGDIHGNNLDTLVNSQNRGTAVGVDFHYDLRRIFWTDTIQNKVFS
VDMDGSNVQVVLNVSVDYPENLAVDWVNNKLYVVEASVNRIDVVDFDGSNRVTLITENLG
NPRGVAVDPTVGYMFFTDWEAINGQPGLERAFMDGTNRYGIIGTKLGWPSGITLDIEAKR
IYWVDSRYDYIETATYDGVHRKTVVHGGAVVPHPFGISLFEHSVYFTDWTKMAVMRANKF
TDSPQVVYNTSQTPHGVAVVHKLKQPHVQNPCGTNRGGCEHICVLSHQSDNGGLGYRCKC
RMGYDLHADGKHCFAVRHFLLFSSQLAVRGIPFNLSSQEDIILPVTGSPSYFIGVDFSAE
DDVIFFSDTAKDMIFKQKVDGTGREVLTANRVDGVEDLAYDWISKNLYWTDPRYRSISVM
KVADKSRRAIVRNLNNPRAIVVHPLIGYIFWTDWYRPAKIMRAWGDGSHALSIVNTTLGW
PNGLAIDWNAMRLYWVDAFFDKIEHSNFDGQNRISLDRITQISHPFGLTIFEGYAYYTDW
RLGGIVRVRKTDGGEMVIIRRGISHIMHVKSFSSTSQTGFNLCNRLTNPNGDCSHFCFPV
PDSQRVCGCPYGMKLLPNQRTCVEDPSNEPPTLQCGANSFSCGNGKCVPNSYRCDGVDDC
HDNSDEVDCGVNNSTCSPTAFTCANTRCVPAAWRCDGHNDCFDNSDESSCPAPAPGTCPA
NQFTCSNHRCVPHSWRCDTDNDCGDGSDEADCQLGSTCHPGQFQCPDHRCIDPSYVCDGD
RDCVDGADERGCIYNCTANEFKCASGHQCINGYYRCDGVFDCTDRSDERACPTRPPGMCH
HESEFQCQSDGTCIPSTWECDGHPDCEDSSDEHHACPPRTCPSTFFRCDNGNCVLRSWIC
DGDNDCRDMSDERDCPTPPFRCPSWQWQCPGHSVCINLTTVCDNTPDCPNGADESPLCNQ
ESCSDNNAGCTHGCIQGPFGAQCTCPVGYQLSNDSKTCGDVDECSPPGICSQHCFNERGS
FRCHCQDGYALEADQRTCKVSGEEEAFLLVASRNQIVQDDITSQPNVVHSLVRDGRNIVA
LDFDSVTDRVYWSDTSQDRIWSASNNGSDRTVIFDSGVTVTESLAVDWVGRNLYWTDYVL
ETVEVSKLDGTHRTVLVSENVTNPRGLVLDPRSSAHLMFWTDWGRNPRIERASMDGKLRT
VIVNSKLYWPNGLTIDYPNNLLYFADAYLDFIDYCDYNGNNRKQVLASDLVLQHPHAITI
FEDFVYWTDRYINRVMRAHKWHGENQTVMLFNLPQPMGLVAVHPARQPAGGNSCLRSPCS
HICLLSAVGPAYYSCACPSGWTLAADQITCTRVEDPFLVVVRDSIIYGISLNPEDKSNDA
MVPVAGLQNGYDVDFDDNEQIIYWVEHPGEIHSVKSDGTNRTEFAPAAILGSPVGLALDW
ITQNLYYTNPSTQSIEVLKLRGEVQYRKTLITNNGSPTGAGSPVGIAVDPARGKLYWTDQ
GTESGIPAKVASANMDGSNPVNLFTNNLDHIEFLTVDIRENKLYWAVTSTGAIESGDPDG
TNRITIVTGLSHPWGVAVYGSHLYFTDRDFEVIERVDKTTGTNRVVLRDNVSGLRVLKVH
YRETSAGVSNGCTDNNMGACEQICLPAPQGFFTCACATGFKLNTDNRTCAPYQSYVVIST
LSAIKGFSLEGEDHSEAMVPVAGRGRNALHIDVHMASGFIYWCDFSSTVAAQNGVRRIKP
DGSGLRSIVTSGIGRNGIRGIAVDWAAGNLYFTNAFLTETYVEVLRLNTTFRRVLLKTQV
DMPRHIVVDPRRRYLFWADYGQHPKIERALLDGTNRTILVSSGIVTPRGLALDWQSGYVY
WVDDSLDMIARVSPQGGETEVVRYGSRYPTPYGITVFENSIIWVDRNLKKVFRASKEPGS
TEQPTVIRDNINMLRDVTIFDRHTQPTTAQELNFNPCVEENGGCAHFCFALPEYGSDGQN
KVCSCAFGNLGADNKGCVVSRDDYLIYTTESTVRSLRLDPDDHALPFPVVNVPRTSVALD
FDLTERRIYFTQSSGAGASKISYVSLSAPTSTPVVVAFDLGAPDGIAYDWINRRIYYSDF
VNQSINSMSVEGSQRTVVVHVSRPRAIMLDPCRGYMYWTDWGTHAKIERATLGGNFRTDI
VNSSLVWPNGLTLDYEDERLYWADASLQKIERSSLTGSDREVIVSTAIYPFAMTMFDQFI
YWTDWNTRSIYRANKHDGSGQRVMIQNLPSRPMDIHVLASRKQQQCDSPCQQFNGGCSHI
CTPGPNGAECHCPSEGRWYLADSKHCIPDNGTRCQPGQFTCMNGHCIRAQWKCDNENDCG
DGSDELERVCAFHTCEPTVFTCGNGRCVPYHYRCDHYDDCGDNSDELGCLFRPCDPSREF
TCNNGRCIAKDYVCNGINNCYDNGTSDEQNCPERTCQPEQTKCQSTNICIPRSYLCDGDN
DCGDMSDESPTHCVASTCSQSEFRCSSGRCIPARWYCDGGADCSDSSDEPLSCTPQVRTC
NTEQFRCDDGRCIASTWICDGDNDCGDMSDEDQRHNCANRTCSNAEFTCVNNQPPQRKCI
PRDWVCDGDADCADALDEHQNCTRRSCGVNEFTCSNGLCIRSSYRCDRRNDCGDGSDEQG
CTYQACQQHQFTCQNGRCISRDFVCDGDNDCGDESDELEHMCHTPAPTCPPGEFRCDNGH
CISLSRVCDRNDDCSDNSDEKGCGVNECTDPSIHHCDHSCTDTPTSFICTCRPGYRLMSD
GKTCDDVNECAETPRVCSQVCENTVGSYVCKCAPGFLREPDGHSCRQNSDIAPYLIFSNR
YYLRNLSTDGAAYSLILQGLTSVVALDFDRVDRRLYWIDVSRRVIERMSYNGSNREVVVT
GVLHGEGLAVDWIARKLYWVDSFSDCLKVSELDGRFVKKLAEHCVDANNTFCFENPRAIV
LHPKYGFVYWTDWGDKAFIGRVGMDGTNKAPIITTKLEWPNGITIDYTNDKLYWSDAHLS
YIEFSDLDGQHRHTVYDGNLPHPFALTVFEDTVYWTDWNTRTVEKGNKYDGSGRQALVNT
THRPFDIHVCHPYRQPIVTNPCAVNNGGCSHLCLIRHGGQEHTCECPDHFLTIQIGGVTR
CLPMCTSTQYRCANNERCIPIWWKCDGQRDCRDGSDEPSTCPVRHCRLGQFQCNDGNCTS
PHLLCNSHQDCHDGSDEDPVLCATHQCENHQWQCANKRCIPESWQCDGEDDCGDQSDEDP
AHCSSRTCRPGQFKCRNGRCIPQSWKCDVDNDCGDNSDEPLEECMGPAYRCDNHTEFSCR
TNYRCVPMWSVCNGHNDCRDDSDEQGCDELTCDPTGDFRCNNHRCIPLRWRCDGDDDCGD
NSDERSCTPRTCTESEYRCDNLRCIPNRWVCDHDNDCEDNSDERDCELRTCHPGYFQCTS
GHCISERFKCDGNPDCLDYTDETSCPTRFPNGTYCPPFMFECKNHVCVQPHWKCDGDDDC
GDNSDEELHLCIDIQCETPFRFRCDNNRCIYSHELCNSVNDCGDGSDEIPENCPNPTHGP
CTDEEYKCSNGHCIPLPYACDDYDDCGDQSDELGCHRGSTHTCSDNICEHNCTDLREGGL
LCSCRPGYKPRATEKHMCEDVNECEVYGTCPQECKNTKGSFECFCAKGFVSIGEPHGTEC
AAQGNPPVLLLPDNVRIRRFNLSSQQYSDYVDNAEHIQALDYLWDPEGQGLSVVYWTVLG
RGSEFGSIKCAYMPTFNDYGSNPVKEVDLNLRYVSKPDGIALDWVGRHIYWTDSGTNRIE
VAKLDGRYRKWLIHTDLDQPAAIAVNPLLRMMYWTDWGRKPRIETAWMDGQNRAVLVDED
LGWPTGLTVDYLNGNRIYWCDSKENTVESMKPDGTDRKAVISGDIGHPYSLDVFEGHLYW
TTKDTGEVWRTNKFGNGHKVKVLTINPWLTQVRVYQEHRHNQTVPNPCKNVCSHLCLLRP
GGYTCACPQGSSFAESDFGICDAAIEPPVTMPPACRCMNGGTCYTDEGGMPKCKCPYGYT
GSYCDMGKIINAPAGTAVAVLLAAIIIIITGALAAGVFLNYKRTGSFIPSMPKLPSLSSL
VKSADTGNGVTFHSGDNVDLGPSHIGVSFIDTAMQMDNNFAMEVGRQPITFENPLYATAP
AASNDPALILVQKVTVNTSGEHLENNFVNPTYSGDQRVSIITTSSSSSKPVQESKWSLFM
RKLKPGTTFQNPSYAEMKDEKPAEGGRDWSAPEPPPFVPPSKPQKRDRPSTFSPTEDSFK
DTATLVKEDMDV
Download sequence
Identical sequences H3CFS5
ENSTNIP00000007102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]