SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007291 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007291
Domain Number 1 Region: 143-234
Classification Level Classification E-value
Superfamily Immunoglobulin 4.08e-21
Family I set domains 0.0095
Further Details:      
 
Domain Number 2 Region: 246-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000012
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007291
Domain Number - Region: 31-112
Classification Level Classification E-value
Superfamily TIMP-like 0.00785
Family The laminin-binding domain of agrin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007291   Gene: ENSTNIG00000004640   Transcript: ENSTNIT00000007449
Sequence length 731
Comment pep:known_by_projection chromosome:TETRAODON8:1:9774799:9818466:-1 gene:ENSTNIG00000004640 transcript:ENSTNIT00000007449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADGMRLDPVHFSMLVIGVSFACYAPSLNSLQDQAYRSAVVIEGEVRSFPENVSSREPYSV
NVKVLDVWPVNSGGLEREQLVTVGDFGSEAPCTTVEKDHKYIFFMDPTTEPLVFKASYAP
VDASEPELKKDVEKVLCEDCASAPKLRLMRGQSLIEGEKLYLKCEASGSPSPSFRWYKDG
HELQKGRDLKIKTNKRKNSKVQISRVRVEDSGNYTCVAENSIGQENATSIISVQILTTTT
PSSGVSHARRCNDSEKPYCVNGGDCYFIHGINQLSCKCPNDYTGDRCQNSVMTSFYKMRS
KSTEAEELYQRRVLTITGICVALLVVGIVCVVAYCKTKKQRKKMHSHLHQNQNQCMEQPH
RMLANGPNHPGPGPEEIPMGDYISKSIPTTECVISHGAEGAGNYAGSRMSTRSHHSTTAS
HASSVCSPHACRNEEQTWSIERTDSMNSDCQSGGLSSSVGTSKCSSPACMARRAAYWGCT
DTSGTGMQYGESYDSLRDSPHSDRYVSALTTPARLSPVEFHYPPLPPQVPTFQITSPNTS
HALSLPPAAAAYYRDDDQPLLRCPESSQAVYDHYDGSLYRQPRRQRRPYLTESPGSLPSS
PYRLPDEEAYETTQEYASSQEPIRSRRRPRRNRLNGHVSQRSGGPRDYSSQSFSQSEEEE
DEGENEAHGESTPFLSMQNMNVDPPLTVPGFRSSADADTRTYRGLSRPGMRSNGQSRGSQ
LQRSRADNTPL
Download sequence
Identical sequences H3CGB4
ENSTNIP00000007291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]