SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007616 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007616
Domain Number 1 Region: 30-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.88e-80
Family Calponin-homology domain, CH-domain 0.0000923
Further Details:      
 
Domain Number 2 Region: 1260-1375
Classification Level Classification E-value
Superfamily E set domains 5.41e-36
Family Filamin repeat (rod domain) 0.0000283
Further Details:      
 
Domain Number 3 Region: 1449-1566
Classification Level Classification E-value
Superfamily E set domains 2.47e-34
Family Filamin repeat (rod domain) 0.00000677
Further Details:      
 
Domain Number 4 Region: 456-573
Classification Level Classification E-value
Superfamily E set domains 5.87e-32
Family Filamin repeat (rod domain) 0.00064
Further Details:      
 
Domain Number 5 Region: 1374-1483
Classification Level Classification E-value
Superfamily E set domains 8.41e-32
Family Filamin repeat (rod domain) 0.000024
Further Details:      
 
Domain Number 6 Region: 1170-1282
Classification Level Classification E-value
Superfamily E set domains 5.6e-30
Family Filamin repeat (rod domain) 0.0000171
Further Details:      
 
Domain Number 7 Region: 1747-1841
Classification Level Classification E-value
Superfamily E set domains 1.07e-29
Family Filamin repeat (rod domain) 0.00000903
Further Details:      
 
Domain Number 8 Region: 1557-1661
Classification Level Classification E-value
Superfamily E set domains 2.27e-29
Family Filamin repeat (rod domain) 0.0000454
Further Details:      
 
Domain Number 9 Region: 854-972
Classification Level Classification E-value
Superfamily E set domains 3.57e-29
Family Filamin repeat (rod domain) 0.00028
Further Details:      
 
Domain Number 10 Region: 1090-1194
Classification Level Classification E-value
Superfamily E set domains 5.4e-29
Family Filamin repeat (rod domain) 0.0000747
Further Details:      
 
Domain Number 11 Region: 672-780
Classification Level Classification E-value
Superfamily E set domains 1.08e-28
Family Filamin repeat (rod domain) 0.00041
Further Details:      
 
Domain Number 12 Region: 2123-2216
Classification Level Classification E-value
Superfamily E set domains 8.67e-27
Family Filamin repeat (rod domain) 0.00000589
Further Details:      
 
Domain Number 13 Region: 379-478
Classification Level Classification E-value
Superfamily E set domains 7.64e-26
Family Filamin repeat (rod domain) 0.00094
Further Details:      
 
Domain Number 14 Region: 1929-2025
Classification Level Classification E-value
Superfamily E set domains 1.34e-25
Family Filamin repeat (rod domain) 0.0000208
Further Details:      
 
Domain Number 15 Region: 564-666
Classification Level Classification E-value
Superfamily E set domains 3.07e-25
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 
Domain Number 16 Region: 278-373
Classification Level Classification E-value
Superfamily E set domains 1.73e-24
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 17 Region: 2314-2404
Classification Level Classification E-value
Superfamily E set domains 4.8e-24
Family Filamin repeat (rod domain) 0.0000163
Further Details:      
 
Domain Number 18 Region: 2221-2311
Classification Level Classification E-value
Superfamily E set domains 1e-23
Family Filamin repeat (rod domain) 0.0000183
Further Details:      
 
Domain Number 19 Region: 768-871
Classification Level Classification E-value
Superfamily E set domains 3.76e-22
Family Filamin repeat (rod domain) 0.00087
Further Details:      
 
Domain Number 20 Region: 2441-2534
Classification Level Classification E-value
Superfamily E set domains 2e-21
Family Filamin repeat (rod domain) 0.000017
Further Details:      
 
Domain Number 21 Region: 2043-2137
Classification Level Classification E-value
Superfamily E set domains 4.2e-21
Family Filamin repeat (rod domain) 0.0000312
Further Details:      
 
Domain Number 22 Region: 959-1067
Classification Level Classification E-value
Superfamily E set domains 2.74e-19
Family Filamin repeat (rod domain) 0.0024
Further Details:      
 
Domain Number 23 Region: 1843-1927
Classification Level Classification E-value
Superfamily E set domains 6.41e-17
Family Filamin repeat (rod domain) 0.0000525
Further Details:      
 
Domain Number 24 Region: 1683-1761
Classification Level Classification E-value
Superfamily E set domains 1.8e-16
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007616   Gene: ENSTNIG00000004951   Transcript: ENSTNIT00000007776
Sequence length 2534
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:73165184:73184635:-1 gene:ENSTNIG00000004951 transcript:ENSTNIT00000007776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSHPRLHQSAAPAPNTLSSDKDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVN
KRIANLQTDLSDGLRLIGLLEVLSQKKFRKYNQRPTFRQMQLENVSVALEFLDRENIKLV
SIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEEADDGKQKTPKQRLLGWIQNKLP
ELPITNFNRDWQTGQALGALVDSCAPGLCPDWDQWDQSKPVDNAREAMQQADDWLGIPQV
ITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGVEPVGNVVMKK
TVFTVETISAGMGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYTPRVTGMHKVTVLFA
GQHISKSPFEVEIGMAQGDSSKATAQGPGLEPSGNIANKTTYFDVYTAGAGVGEVEVIIM
DPSGKNSTVKCNIEDKGNNSYRCTYKPTQEGQHIISVTFAGGQISRSPFTVSVGEACNPN
LCRAKGRGLQPKGLRVKETADFKVYTKGAGTGELKVSIKGPKGLEEPCKRKDLGDGVYGF
EYYPTSPGTYSITITWGGQHIPRSPIEVKISPEAGQQKVRAWGPGLEGGVVGKSADFVVE
AVGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCNNEDIQHSPFM
AEIVTPPSKDFYPDKVKAFGPGLQSSGLAVGKPTEFTVDAKHGGKAPLKIVAQDGEGVPV
DVQVKDNGNGTYSCSYTPRKPVKHTAMISWGGVNIPDSPFRMNIGAGCHPNKVKVSGPGV
AKSGLKAFEPTYFTVDCSEAGQGDISIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYT
PPGAGSYTIMVLFADQAIPMTPIRIKVDPAHDASKVKAEGPGLSRTGVELNKPTHFTVST
KGAGKANLDCTFSGPTKVEAAKDVEVINNHDNTHTVKYTPVQQGPLGIGVTYGGDHVPKS
PFTVTVAPTLDLSKISVAGLGEKMTVGKDQDIIIKTKGAGGQGKVGAKVTAPSGKPVASK
VEPGLSPETSQVKFIPREAGPYQVELTYDGVPIPGSPFSPTAYSASDPSKVGRPRRQKDL
HVLNNNTSPQVRCSGPGLERARVGEKGEFFVDCTNAGPADLTIEIISDSGTEAEVHIQDN
GDGTYTITYIPLYPGSYTLTIRYGGQDVPNFPARLNVEPAVDASGVRVFGPGVESKGVFR
EATTDFTVDARALAPNGGDHIKTLISNPSGSCTDALISDLGDGTYSVAYTPYEEGPHSVE
VCYDGMPVPKSPFHVAVTEGCNPGRVRVHGPGLKGGTTNKPNKFTIETRGAGTGGLGLAM
EGPSEAKMSCIDNKDGSCSVEYVPYEPGTYNLNITYGGQPITGSPFSVPVSDTVDSTKVK
CQGPGLGNNVRANIPQAFTVDASKAGVAPLQVRVQGPKGVVEPVEVVDNGDQTHTVNYVP
TREGPYSINVLYDDEEIPRSPYKVKVLPTHDASKVRASGPGLNTTGVPASLPVEFTIDAK
DAGEGLLAVQITDPEGKPKKANIRDNHDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYR
IRALPTGDASKCTVTGAGIGPTIQIGEQTVITVDAKAAGKGKVTCSVCTPEGAELDVDVV
ENEDGTFDIFYTAPQPGEYVICVRFGGEHIPNSPFQVTATDRPMGMNGLDVAGLRPFDLV
IPFTIQKGEITGEVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYEGIHIPGS
PLQFFVDYINSGNVSAYGPGLIHGTVNKPAVFTVDTKDAGEGGLSLAIEGPSKADISCVD
NQDGTCTVSYLPVLPGDYSILVKYNDKHIPGSPFSARITGDDSMRMSHLKVGSAADIPLD
IGELDLTQLTASLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPNSP
ISVMIRESEIGDASRVRVSGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINT
EDQEDGTCKVTYCPTEPGNYIINIKFADQHVPAGSAFTVKVTGEGRMKESITRKRRAPSV
ANVGSQCDLSLKIPEINMAEMTAQVTSPSGQRHKADIMEGENNTYCIRFVPTETGVHTVS
VKYQGSHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSI
AVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIRFNDEHIPDSPFIVPVASPSDDAR
RLTVASLQESGLKVNQPASFAVSLNGAKGMIDAKVHSPSGALEECCITEIDQDKYAVRFI
PRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGSTGSACEFLVN
TSKAGPGALAVTIDGPSKVKMDCVECPEGYRVTYTPMAPGSYLISIKYGGPYHIVGSPFK
ARISGSKLVSSHSAHETSSVTVDPVTRAISCSPAGASSQSDASKVLAKGLGLSKAYLGQK
NSFSVDCSKAVFTGRNMLLVGVDGPKVPCEEILVKHLGNRMYNVSYQLKEKGEYILVVKW
GDEHIPGSPYHITV
Download sequence
Identical sequences H3CH88
ENSTNIP00000007616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]