SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007675 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007675
Domain Number 1 Region: 20-162
Classification Level Classification E-value
Superfamily E set domains 2.17e-17
Family Arrestin/Vps26-like 0.026
Further Details:      
 
Domain Number 2 Region: 167-305
Classification Level Classification E-value
Superfamily E set domains 8.4e-17
Family Arrestin/Vps26-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007675   Gene: ENSTNIG00000005009   Transcript: ENSTNIT00000007836
Sequence length 395
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:73587637:73589942:-1 gene:ENSTNIG00000005009 transcript:ENSTNIT00000007836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAMSKRIKSFRVLFADPAKSFFCGGDVVSGRVEVEVNEATRVSAVRLLALGRAKVEYAK
GKQRCRQEAEYLRHEELLRLESQPTDSDGSVLLRPGNKYEYSFGFELPQNGQLVSSYKGK
FGYVHYCVKAVMERPQQPALECKKAFEVEEPLDVNTPDLLSPTGGMKEKKVTCMFIPDGQ
VSLNAKIDRSGFCEGEDICINAKFENCSRIVVPKAAIIAKHIYQANGRTKVFRQKLSSVR
GNHIISGMCDAWQGKTIRVPKIKPSMLSCNIIRVEYALMIYVHIPGSEKLILELPLVIGT
AGLGSRSNSVSSQEGSVSNASQSWVSLRVPSDPPSYCDITRDCRLDQPLTPLLDDCDGED
SPIFMTAPAFQFPPPPAYAETEEEHGAHPRMLPVC
Download sequence
Identical sequences H3CHE7
99883.ENSTNIP00000007675 ENSTNIP00000007675 ENSTNIP00000007675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]