SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008162 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008162
Domain Number 1 Region: 1049-1129
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000407
Family E-set domains of sugar-utilizing enzymes 0.014
Further Details:      
 
Domain Number 2 Region: 1803-1885
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000578
Family E-set domains of sugar-utilizing enzymes 0.047
Further Details:      
 
Domain Number 3 Region: 1977-2065
Classification Level Classification E-value
Superfamily E set domains 0.000000000000187
Family Other IPT/TIG domains 0.078
Further Details:      
 
Domain Number 4 Region: 1721-1797
Classification Level Classification E-value
Superfamily E set domains 0.000000000000355
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.087
Further Details:      
 
Domain Number 5 Region: 960-1034
Classification Level Classification E-value
Superfamily E set domains 0.00000000000583
Family E-set domains of sugar-utilizing enzymes 0.019
Further Details:      
 
Domain Number 6 Region: 3217-3323,3349-3446
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000112
Family Galacturonase 0.046
Further Details:      
 
Domain Number 7 Region: 215-303
Classification Level Classification E-value
Superfamily E set domains 0.000000000815
Family E-set domains of sugar-utilizing enzymes 0.03
Further Details:      
 
Domain Number 8 Region: 1229-1287
Classification Level Classification E-value
Superfamily E set domains 0.000000000934
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Domain Number 9 Region: 1636-1711
Classification Level Classification E-value
Superfamily E set domains 0.00000000201
Family E-set domains of sugar-utilizing enzymes 0.018
Further Details:      
 
Domain Number 10 Region: 318-440
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.00000000209
Family Anthrax protective antigen 0.035
Further Details:      
 
Domain Number 11 Region: 1550-1627
Classification Level Classification E-value
Superfamily E set domains 0.00000000344
Family Other IPT/TIG domains 0.034
Further Details:      
 
Domain Number 12 Region: 1455-1531
Classification Level Classification E-value
Superfamily E set domains 0.00000000518
Family E-set domains of sugar-utilizing enzymes 0.049
Further Details:      
 
Domain Number 13 Region: 1891-1973
Classification Level Classification E-value
Superfamily E set domains 0.0000000315
Family Other IPT/TIG domains 0.092
Further Details:      
 
Domain Number 14 Region: 1297-1394
Classification Level Classification E-value
Superfamily Cupredoxins 0.00000394
Family Plastocyanin/azurin-like 0.061
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008162
Domain Number - Region: 2374-2599
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000188
Family Galacturonase 0.066
Further Details:      
 
Domain Number - Region: 86-135
Classification Level Classification E-value
Superfamily E set domains 0.07
Family E-set domains of sugar-utilizing enzymes 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008162   Gene: ENSTNIG00000005470   Transcript: ENSTNIT00000008328
Sequence length 4055
Comment pep:known_by_projection chromosome:TETRAODON8:21:640980:669038:1 gene:ENSTNIG00000005470 transcript:ENSTNIT00000008328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFAQERQFQLNPTDDSFGNRVTFVSSTLSFPCDVERDSTHGGQILCYTRAMPSEYYGLHV
TVDGVPTVVCNGNHFHPYCRFYTVNYRTPTINTVSPITGPPGSVFTIRGRIYTDVYGSNT
KLSSNGRDVRFLRSYIGGMPCDLLKPQSDELYQLQLDNENSVWGYMSCKMAGTYVGHHNL
SYILDDEYGRSLPDKPLYWVSGVGKLAMIQTYAEVTGVSPSKGSVEGGTLLTVDGRFFDQ
TDQPARVFVGGLPCEIENVSDDRITCRTAKQDPASKKTVYPGGRGLKIEAWNDTRSNQLS
DVFSFNESRPGYWTEWTDILPKIFLFDFQYFSTRSRGFFVPPESGNYMLYIHCDDRCELY
LSNSSLPEHKVKIAYQPRYTGSMFSFESQRSELMALEGGEYYYLEILHQEFWGAASFNVG
LFSEKSSFTETQTDDAVNEVQDIVAQYDVFDDEYVIIFTSMPQNTVTINEVQVVTVKSNC
SSQLCGSTFYRLGYEAAMTGPIPVSASAAMVEAALNSLWSIKPDTVRVTKQDDSQGSHYT
VTFSSDRGIKGCVHLLLLLQQLVHVSYLIQAKSKGCFDLKYFTCHGSVFNYCVERMFVQR
KSQRLSRLEEQFLKLPCVLQYCCCKYHSTKQFNVTVTDFWIKTEKPLASVYFAIKVDVFL
NFILSDNKCLQKSQHRQTLYYNKYYCCTILFYLHSRFSTAVMIWLSTWMERRLSISHASA
GLLHLCRAPSMWRSLEAGPKVVTTHKLPSKLALCYCDSKLSKNDAHYFTQNVSLDKFPTY
FEYCCSITVILNNIYLLCCRVILKCLRFEIIFRTLSLSLCVIYSVLQVFGDKKLTLFHRD
EWLSVGINEEDLKYALEGIEGMGQLSVQWQGTCRSPKWRVEWLSKPGDQPLIQVNDSSVF
GGTNIVVSAEEKKKGGLLMRSIAGDLLRVCESKPQVEVLINGIPSKCSGDCAFEWSEDRT
PVVTEINPSQGSIGLGTLLTVTGTGFISENASILVGTAKCHVEQITNTTQVCRLGSATAG
TYPVTVSFPSLGHSRYAEGNVFNFTYQLIITSFSPSSGSIADIGGTLLTVGGFGFSENAT
VTIGSNECKVVHATDTELKCRTPAGTAGSQTITVTVSKMSQAASSSFTYDAGLTPQISGL
SPSTTTVTGELSLKEMKRLKEKYATCSTSCLIGRSSCDFSDTPFSNVFACTSLVVIPACR
HLLEIQALQTHIVSHSNSVNATIEYILEVHSVSPLYGSLMGGTRLTLSGSGFSNNISDNR
VFFGDAECEVKDASENELQCILQTEQKTHIVTNQGSHYIYGQGYAWSTPSLTISVGDTVK
WSWEAPPFLNTGYRVFSVSTPSGTTYEGGPFNSGDTKTAKGSFMYRFTIPGVYYYSSGYL
DDSNVKIMQGVVKVQPLVDKSNRIVVYVGGIEAKHVTGGEWSHRVSRATSGCVALPQCLQ
SNSISDPFSFTASTCSTPTVHAISPNQGSYHQILHIQGNGFGNTTCAIEVIVGGQPCEVI
NSTNADIMCRLRYDNRLPIGVAHAVVVRIANLGDAVIAIADELSRRFVLLPAVDSLAPSI
GSPTGHTRLHIKGSGFPEGHVTVASEWCAIVSVNYTSVICDTSPSQPHGGDVIFQIGNIQ
SSCHSNCEYMYSSSVTPALTTIAPNNISETTDVVIYGSGFGNHADDVVVFASNTELRITN
VNDGNISARVDALPAGDHPIKVIVRSKGLASGILTLSSLPVASLSPLEGSLAGGTSLTFT
GNGFAPGNTSVLIGGQPCEIRHVTPSTLHCITPPHVEGQVRTDIWVLSTQYPPLTFNYSA
TQTPVLSSITPITGSSGAVVTLAGSGFGADLQQISVTINSVPCNVSTVTDTQVYCKTGNN
PGGTYRVMLYHKEKGHAQSDVTFTYEMSLINVQPNEGSFGGGALLTVVGSGFEPSNSTVT
VCDEECKVHRDMSSSSHLFCQSPFNNGSQDTLSCTVVVSNKLKTVNISNGFTYKSQLTPV
ITEVSPRRGGTAGGTSLTITGSGFSTNTHEVNVTIAGSVCDVQSANVTHIICVTNAQRQS
QETKVRVSIKDQGVAKMDNADFFYIDVWSSRFTWGGLPPPEKGSFAVITEGQTILLDSST
PVLKMLLIKGGTLVFDEADLELQAENILITNGGRLQIGQEGAPFKHKAIITLHGNLRSPE
LPVYGTKTLAVREGVLDLHGIPVPVPWTHLAETATNGSVTLRLKKAVTWPVGGEIVVAST
GHRHSQQENEVRKLTAVSQDGLTLTLNEPLKYTHLGVSVTLPDGTVFEARAEVGLLTRNI
VVRGSQHQEWNDQIEACPDGFNTGEFTTQTCFQGRFGEEIGSDQFGGCIMFHAPRPNENL
AIGRLEYVEVFHAGQAFRLGRYPIHWHLMGNINYKSYVRGCAIHQTFNRAVTIHNTHRLL
VEHNIIYNIMGGAFFIEDGIETENILQYNLAVFVKQSTSLLNDDVTPAAYWVTNPNNIIR
HNAAAGGTHFGFWYRMHTNPDGPSYDPNICQKRVPLGEFHNNTVHSQGWFGLWIFQEYFP
MKNGGCRSTIPEPAVFHSLTTWNCEKGAEWVNVGAVQFKNFIMVNNEKAGIEAKRILHNY
VTDFGEDGGATMSNCTVVGHVDELGLGENYCSHRGIIAPFDDGLSVLGTKFINFDRGSCA
AIGVTSIDGTCLDRCGGWAVRFRDIQYFNSPNKAGFRWEHEVQLVDTDGSLTGTINHKVV
PMSDLLDPNHCSQSPEWSLGFPGAICDHTVNFHRLAFNNPTPSSLNAKDVILTNSYGSSV
IPYLKKRMTHKFGWMALLPSGQTYNWYFRDMDHLTNITYSAKYYGFGSDQFVIINHNLTQ
SPDLFDIIDKRNGSVTPLSFSSNINGDWFFNTSSNNLYYIMVKYQETSQRKRRNSVDRSL
MDSVVDFRVYRCFFPQCIPPPPPPPATLAPLPDGRPDNFVLWSSATFWLNSPENNFTAPS
EGADVVIPSGAWVVLDSSTPPLNKLTIVGVLEIVEMTNSSSNRQTRAAPEINPLLINAVY
ISIQGGRLFAGRDNEPFRGQLHIKLRGNHKTPDWPLPNGPNQGSKVLGVFGTLELYGQPH
SVYHTKLAATAAAGSNTLTLAKTVDWKIGDEVAISTTSYNASETEKRWITAVSADSRVLT
LNQPLNYTHIGETHSVSGTSFSYTLAADVALLTRNIRIIGEEYPEMMKESFGARLLVGTY
SSAGINYKGTAQIRNVEFFHSGQEGWTDSTDPRFSATFLNLGKVPTPGDTYIQGCAFHDG
FSPALGVSGTEGLNIDDNIIHHTVGEGIRIWGNNITLRRNLVMMTLWPGSYQDREEPFNF
DWNAAIEVSQGTNVVLQHNIVAGYERVAYRIDGEPCPGFLNENEKWVDNEAHGGLFGVYM
NKDGLPGCSQIRGFFIWKSFDHGIYFQTIMRIVVSNVTLVDNGLGIMPFIYAPPSLSHAF
ADKPVHIQNALIVGSSPNFNCFDTLSNSDFNILNSESHRAPRPLNGGRSGICWPNFASGH
NTAPAKPHHLNMNYNAIKGLMTVQNTVFVGFRNVCSSETNIMFMTNPINEDLQHPIHTSG
ITMVDSTEEAEIFIHRPDVSKANPSDCVDMDCDAKKKTLLKDLDGSILGTVGSVIPQSEF
EWNGDPRRGLGDYRIPNVMLTFPNGSRIPVDQIAPHKGVIRKDCIYMRTWQGYKCTGLDY
RMLVIESLDADTETRRLSPVAVLGDGFVDLINGPQDHGWCAGYTCQKRVSLFHSIIATNH
SFDIFFSSVSPQKLRLMMLHADPAESILVSVFYSNPQRLDVYTDNVLVAPTNAEWNAANT
DYTLRKPSYSGQYVPQLSDALGTNFFDQDYKMLKVLVRGSQPVEIRTSPLLVIAFELPAM
TEDEFFGDNLVQNLAAFLKIPPDMIRITKIIPENAGARRRKRSTSLKVEVEIKKLPVQQM
SNSTDNEEDFTLLKSLADNLGQAAVSGNLSQSIGFNVSSMGIIPPPPSSSDESWKEEANA
EVTREEPTVSYVSSVNNLLLMVEPIAGEFVGPLYQQPSLMAVDEQGNCVAVGVTTLTVTA
SLKDASGNSISSLQGNTTILFTSCWANYTDLSIPH
Download sequence
Identical sequences H3CIT4
ENSTNIP00000008161 99883.ENSTNIP00000008162 ENSTNIP00000008162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]