SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009102 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009102
Domain Number 1 Region: 156-351
Classification Level Classification E-value
Superfamily E set domains 2.75e-73
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000391
Further Details:      
 
Domain Number 2 Region: 50-172
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.77e-23
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009102   Gene: ENSTNIG00000006341   Transcript: ENSTNIT00000009273
Sequence length 425
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:19934017:19938210:1 gene:ENSTNIG00000006341 transcript:ENSTNIT00000009273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSCPSSLLVSTSVQPVQPPAIFFSARARRKRQRYVEKNGRCNVQHGNMQETYRYLTDIFT
TLVDLNWRCSLFVFVMAYAVTWLFFGAIWYLIAYCRGDLDHLGDSNWTPCVNNVNSFISA
FLFSIETETTIGYGHRVITDQCPVGTMLLLLQAILGSMVNAFMVGCMFVKISQPNKRAET
LVFSKHAVISLRDDKLCLMFRVGDLRSSHIVGANMRAKLIKSKQTQEGEFIPLDQTDISV
GFETGDDRLFLVSPLVISHEIDTHSPFWDMSQAQLEKEDFEIVVILEGMVEATAGMTCQA
RSSYLAEEVLWGHRFSPMMSLAEGFFDVDYGAFHHTFEVDTPSCSARELSLAAARLDAHL
YWSISSRLDEEPTLISQAAKQADSSTADSRGDPALTLGEMTNIQEQPGLGELNGSVTTDQ
SETQA
Download sequence
Identical sequences H3CLH3
ENSTNIP00000009102 ENSTNIP00000009102 99883.ENSTNIP00000009102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]