SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009492 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009492
Domain Number 1 Region: 128-370
Classification Level Classification E-value
Superfamily vWA-like 2.16e-77
Family Integrin A (or I) domain 0.00000048
Further Details:      
 
Domain Number 2 Region: 369-456
Classification Level Classification E-value
Superfamily Integrin domains 5.23e-27
Family Integrin domains 0.0022
Further Details:      
 
Domain Number 3 Region: 616-695
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000196
Family Integrin beta tail domain 0.0027
Further Details:      
 
Domain Number 4 Region: 26-80
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000518
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 533-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Integrin beta EGF-like domains 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000009492
Domain Number - Region: 500-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000112
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number - Region: 575-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000201
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Domain Number - Region: 462-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family Integrin beta EGF-like domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009492   Gene: ENSTNIG00000006708   Transcript: ENSTNIT00000009666
Sequence length 763
Comment pep:known_by_projection chromosome:TETRAODON8:2:9386447:9390790:-1 gene:ENSTNIG00000006708 transcript:ENSTNIT00000009666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLSGVSQKALWVCVCAGLCQAGGECKTVASSCSDCIRSGPDCVWCMQENFTKPGEQETAR
CNTIKVLTERGCAPPKIIFPQNNITVLKKLPLSESFARQEPIQLSPQAIHLKVRPGSPTT
FRVSYKRVQGYPVDLYYLMDLSNSMKDDLKNVKQLGNGLLTALKTITEHAQIGFGAFVDK
TVLPFTNTNEKKLQTPCDDNDCQAAFGYRHVLSLTPSEEEFKKKVETQLISGNLDPPEGG
LDAMMQAAVCGDTIGWRNSSTRLIVLATDAGFHMAGDGKLAGILEPNDQRCYMKDNLYYK
SRVMDYPSVGQLAVELEKNNIQTIFAVTENVNNVYKQLSAMIPKSEVGVLSADSNNVVDL
IKTAYSKLSSKVTLTHDRLPKDVQILYTPDCQAAGQPGPSEGVCDNVKEKQEIAFNVTVV
ANSCMKDQSFTVRVLGIKDTLTVTVSTNCECDCRDTQDSQQQACSGRGSLKCGVCSCNDG
FIGQSCECSIGNKDEQTLRDSCRRDKGVECEGRGDCVCGRCHCHGSYHGDFCQCDDEHCE
RFQNKLCGGNGKCSCGQCRCNEGYEGSACQCKVSEEACQTPNNTVCYGRGKCTCSRCECN
DGYQRPHCKTCLGCPDPCQTKLKCIECLGFNSGPFKANCSDACGSVTKVDRFTGESKQCE
LKDSEGCWIKFSLEQIVGPDDYYARIQSERVCPAPAISKAIIGTSITSVAVIGLLVLMVI
KLLIINKCRMYDMDKKKSKQTDVSLLLYHHFDAKQPINFQRFC
Download sequence
Identical sequences H3CML1
ENSTNIP00000009492 ENSTNIP00000009492 99883.ENSTNIP00000009492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]