SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010459 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010459
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily E set domains 0.0000119
Family Arrestin/Vps26-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010459   Gene: ENSTNIG00000007644   Transcript: ENSTNIT00000010640
Sequence length 298
Comment pep:known_by_projection chromosome:TETRAODON8:7:10817687:10819953:1 gene:ENSTNIG00000007644 transcript:ENSTNIT00000010640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVTLDIRLKRANKVYREGEVVSGVIVMVCKEAVQHHGIFLGMEGLVSLQLSSKSVGVFE
AFYNSVKPIQLISSNIEVAKAGKVPPGKTEIPFEFPLNTKSNKVLYETYHGVFVNIQYTL
RCDLKRPLLAKDLSKNCEFIVHCQPQKAKVNPTPVNFSITPDTMQNVRERSTLPKFLVRG
RLDATNCVISQPLSGELKVEASDVPIKSIELQLVRVETCGELCRSNARDATEIQNIQIAE
GDVCRGLAIPIYMVFPRLFTCPTLETTNFKVEFEVNVVIVLQDDHLITENFPLKLCRV
Download sequence
Identical sequences H3CQC5
ENSTNIP00000010459 99883.ENSTNIP00000010459 ENSTNIP00000010459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]