SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010563 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010563
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.74e-59
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000396
Further Details:      
 
Domain Number 2 Region: 176-303
Classification Level Classification E-value
Superfamily E set domains 2.8e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000431
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010563   Gene: ENSTNIG00000007745   Transcript: ENSTNIT00000010744
Sequence length 313
Comment pep:known_by_projection chromosome:TETRAODON8:16:1649972:1651703:-1 gene:ENSTNIG00000007745 transcript:ENSTNIT00000010744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRLLVVEEPKQRGMRFRYECEGRSAGSILGASSTETNKTQPAVEIQGPIERLKKVTLTVS
LVTKDPPHRPHPHCLVGKDCPEGSGICQTRPSFCLCSFANLGIQCVRRKELDVSLQKRRS
QNIDPFQTGDSKGIEDMDMNAVRLCFQCELEWDDGRKDCLSPVVSSPIYDKKATTTSQLK
ISCLNQYRGSCAGKTEVYMLCDKVQKDDIEIIFRKGSWKANGEFAQTDVHRQIAIVFKTP
PYQDQDIAEEVEVSVSLRRISDQMESEPIGFTYLPHNPDPYEVKRKRKQTAPPWQSSPST
SQTKGSAPPSPPP
Download sequence
Identical sequences H3CQM9
ENSTNIP00000010563 ENSTNIP00000010563 99883.ENSTNIP00000010563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]