SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010785 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010785
Domain Number 1 Region: 14-153
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.2e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00035
Further Details:      
 
Domain Number 2 Region: 761-940
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.3e-37
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 312-497
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-32
Family Laminin G-like module 0.0035
Further Details:      
 
Domain Number 4 Region: 127-313
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.16e-29
Family Laminin G-like module 0.0079
Further Details:      
 
Domain Number 5 Region: 947-1152
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.13e-28
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 6 Region: 556-613
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000034
Family Fibrinogen C-terminal domain-like 0.0052
Further Details:      
 
Domain Number 7 Region: 526-562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000295
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010785   Gene: ENSTNIG00000007963   Transcript: ENSTNIT00000010966
Sequence length 1286
Comment pep:known_by_projection chromosome:TETRAODON8:15:1549424:1574127:1 gene:ENSTNIG00000007963 transcript:ENSTNIT00000010966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTEACDAALVSGLPPASFRSSSQLSSSHAPCFAKLNRRDGAGGWSPLSSDRYQWLEVDLG
QRTEVTAVATQGRYGSSDWLTSYLLMFSDTGHNWKQYRQEDSLGSFPGNSNADSVVQYKL
QQPVVARFLRLIPLGWNPNGRIGLRLEAYGCPYTSDVASLDGSSSLVYSPSPSLKRTYRD
VITLKFKTLRNSGMLLHAGGGDGLGLSLELDKGKLQLLLTQGGASSAEPRRLASLGSLLD
DQHWHRLSVERRGLHLNVTVDQHTEKVRMPAEFSHWDVQQTQLSVGTGQRLGAQTSGDSG
GNFHGCLENLLHNGHNLIELARLKSHQAAAVGNVTFSCSEPLSVAVTFSGPQSFLQLPGV
PKSSSGGVSVGFQFRTWNKAGLLLTFVLPQEGGVAWLYLSEARLRLQIHRAGRVLLELSA
GSALNDGQWHQAELKCRRGRLSIVVDKEERSSAHASHSPSVTIENKIFFGGCPAEGDGRD
CRNPFNAFQGCMRLLALDDQNINLILVQQKQLGAFGNLQIDMCGVIDRCSPSPCEHGGRC
TQSWTGFHCNCSDSGYSGATCHSSAYERSCEAYKHAGSTSGLFHIDVDGSGPIRPQLVYC
NMTEENTWMEIQHNNTELTQVRAAPGANQRSVHFDYSAREEQLAAAIGQSEHCEQELSYH
CRKSRLLNTPEGSPFSWWLGGPGPGHVQTYWGGLSPSQQCACGLQGDCIDPQHYCNCDAD
RAEWAQDSGPLTHKDSLPVRALLLGDIRRPGSEAAYRVGPLRCHGDKNFWNAAFFDKETS
YLHFPTFHGELSADISFLFKTTASSGVFLENLGIKDFIRIELSSSSQVLFSLDVGNGPLE
VRVDSGVPLNDNRWHRVRAERNIKEASLQLDDLPTATQKAPAEGHFHLQLNSQLFIGGTA
SRQKGFRGCIRSLQLNGAPLDLEERARITPGVRPGCPGHCGSYGSFCQNHGRCLERHAGF
RCDCARSAYAGVFCQTEVSASFKPTTSVSYTFKEPYELIRNSSAVPSSIHTDVTLRGENV
TLSFRTFQSPTVLFYVSSFQREFLAVLINKHDKLEVRYKLDGSRETEVMRSRVKNLANGR
LHSVSIRRLWESVSVQIDQNAREDFNLTSDGELNAIKSLVLGKVHGSDDLDPDLLRLGSL
GFTGCLSVVHFNSISPLKAALLHPDTSPVTITGPLLRSGCGSASANPYASEDTHQLTDQS
GSVGSGQPLVNAIGTDSALIGGIIAVVIFVMVAGLAVAGRFLYRRKETYRNQEVKSVKPE
DGPDFPFSSQAESQNASEENPKEYFI
Download sequence
Identical sequences H3CRA1
ENSTNIP00000010785 ENSTNIP00000010785 99883.ENSTNIP00000010785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]