SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010857 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010857
Domain Number 1 Region: 417-686
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.91e-65
Family Eukaryotic proteases 0.000025
Further Details:      
 
Domain Number 2 Region: 176-287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-24
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 12-130
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-19
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 4 Region: 359-432
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000594
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 296-362
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000124
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 6 Region: 128-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000664
Family EGF-type module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010857   Gene: ENSTNIG00000008035   Transcript: ENSTNIT00000011039
Sequence length 688
Comment pep:novel chromosome:TETRAODON8:8:9139431:9142597:-1 gene:ENSTNIG00000008035 transcript:ENSTNIT00000011039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLSLLLLLHCHWASSTLLGWVESPGYPHGYLPHASLNWSRCARKGHIISIRLVHLDLE
KSRNCENDAVKVLSDGSPISILCGKKSFAELQSSVNPLLRSSTGGCLTLLFASDYSNTRR
HSGFRGFYTEQDFDECRDDPEASCNQFCHNFVGGYYCSCRHGYHLKEDQRTCTVRCSEDL
SGLREGALSSPSWPAPYPAHAHCLYTLSVDEHLQVELHFSDGFDVEQSTDGHCVDTLTID
TPSGNLGSFCGRQPPPSPFLTHSSRVRIYFTSDGFGTQKGFSLRFRTRDKVCPAAVTPHS
TITPQQPEYPQGQKVTVRCDRGYVLSNVQNSVSMSSDYVTTCQRTGVWFPTHACEPVDCG
IPFIPEDAILQVARTHGGRTLYEDQIRFECKSKYYTLEGPDTYTCSADGEWLSVGGSSEM
PKCVEACGKPEVPLHETQRILGGTDANLGHIPWQLLIRQPRKGGASLINDRWAVTAAHVV
ENVKADALRLYGGLVDENTGLGNSVVMESERIIIHPDYARGTARRTNFDSDIALIKLSSA
VNLGPNLIPVCLPTANMSLVENELGTVSGWGITDRPSGGGLVTSSSLKYAHISVYSLAKC
RDLSFSPRDTPMVFTDNMFCAGADGMDSCLQDSGGPFTSPMLGNGKGPFYLTGIVSWGPP
CRQRKYKGYYTKVENYVDWIKETIEKNP
Download sequence
Identical sequences Q4SNE7
99883.ENSTNIP00000010857 ENSTNIP00000010857 ENSTNIP00000010857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]