SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010899 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010899
Domain Number 1 Region: 283-459
Classification Level Classification E-value
Superfamily E set domains 1.12e-64
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000371
Further Details:      
 
Domain Number 2 Region: 155-203,239-299
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.45e-23
Family Voltage-gated potassium channels 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010899   Gene: ENSTNIG00000008074   Transcript: ENSTNIT00000011081
Sequence length 535
Comment pep:novel chromosome:TETRAODON8:8:8773450:8775709:-1 gene:ENSTNIG00000008074 transcript:ENSTNIT00000011081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAARVKRRFSAVVDGPVEEEEVMRLALSDADTAMVGGGPASSPSSPPPTHALNGKLVPF
QDIAVTARRQSVIGESVRGDAGEGGMRARGMCSGIVKGSGKGGRVKGRSPSDQDSLSSPS
TTSRRCTRRSSRRPRQRFVGKDGRCNVTFVNMSERGQRYLSDLFTTCVDIRWRWMLIIFT
LSFLLSWLLFGFAFWLIASAHGDLSIGLPPGSGSSPGPGGTGSGGGSEKEETVGEPCFLQ
VNSFMAAFLFSLETQTSIGYGFRSVTEECPLAVVAVVLQCIVGCIIDAFIIGAVMAKIAK
PKKRNETLVFSDTAVVALRDGKLCMMWRVGNMRKSHLVEAHVRAQLLKPRVTEEGEFLPL
DNVDINVGFDTGTDRIFLVSPVTIVHEINDESPFFEIDRKTLEKDNDLELVVILEGMVEA
TAMTTQCRSSYVASEILWGHRFEPVLFERKECYQVRKAEIGTCSRWTTRFSIGHMKSQTH
HHAVLKSLQSRKAFKAHAHLSAMKMKWLCSSRHRIMNLIKPKTLTVPRHQQEDSP
Download sequence
Identical sequences Q4SN97
ENSTNIP00000010899 ENSTNIP00000010899 99883.ENSTNIP00000010899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]