SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011053 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011053
Domain Number 1 Region: 6-92
Classification Level Classification E-value
Superfamily E set domains 8.26e-16
Family Other IPT/TIG domains 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011053   Gene: ENSTNIG00000008223   Transcript: ENSTNIT00000011235
Sequence length 924
Comment pep:known_by_projection chromosome:TETRAODON8:1:21781346:21804854:-1 gene:ENSTNIG00000008223 transcript:ENSTNIT00000011235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPARQPPLVTGISPKEGVAWTKVTIRGENLGTGPADLIGLSICGHNCLLTAEWMSASKI
VCRVGPAKDDKGEIIVTTKSGGLGTSTVSFKLLRPERIGILDQSAVWVDEMNYYDMRTNR
NKGISPLSLRPSNPLGIELDKGKIPQKDMELIFPGMSGDFTSENFSATWYLIENHSESSF
EQLKVAASNLKKQATKKNEGSLAYVKGGLSTFFEAQDALSAIHQRLESDGTERVGGSMTQ
RLENILNRASDTADTLFQEVLGRKDKADSTRNALNVLQRFKFLFNLPLNIERNIQKGDYD
VLINDYEKAKSLFCNTEVPFFNKVYSLVETRIQALRHLCCDNHIPLYSSVHSYLCICRYL
SDLHAPGDPAWQCICAQQKWILQLMQNCRDEFISGQRVSVGALDLDGDTRPSALGRLSHA
TSLKRGGSLRIPRSNTWHYETPQRVQFVEKLSDVVIGQLPNFWKLWISYVNGSLFSETGE
KSGQVEKSKKNARQRQNDFKKMIEEMTHRLVKLVRGALLPTTLPKSEQNLYGGWDNKTDL
SGNWLTQIMHTVRACHEALSALEIPNDLLQVIQDLLLSLRVHCLMVTLEHTAEDVKTLAE
KEDWVVDNEGITSLPSQFEQCLVQMLQSLKEPLEVKPGEINVLQLERVQVQTTELIVKIL
KVFINCLEQLSIRTDRDMDLSHDISVDLSSPDRFPGIQEGFSPTPEQRLLIILSNCQYLE
RRTILNLADHFEKHGFAGTEKITQISVEAVRQLDKNLFEAYVERRADPIAGSLEPGIYAG
YFDWRDCQTPTASGVRNYLKEALVTIITVHAEVFTVSQDLVPRVLSKIIESVADEMCRLM
QCVSSFSKNGALQARLEICALRDAVSTYLNPESIASFKLALDALPQLHSGADKKLLEELL
NKFKSSMQLQLTCFRPCCVQPVKR
Download sequence
Identical sequences H3CS19
ENSTNIP00000011053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]